Protein Information

General Information
MoonProt ID1
First appeared in release2.0
Name(s)Fructose-1,6-bisphosphate aldolase, fba
UniProt IDA0A0E2ZJV3
GO termsGO:0003824 catalytic activity GO:0004332 fructose-biphosphate adolase activity GO:0008270 zinc ion binding GO:0016829 lyase activity GO:0016832 aldehyde-lyase activity GO:0046872 metal ion binding GO:0005975 carbohydrate metabolic process GO:0006096 glycolytic process
Organisms for which functions have been demonstratedFrancisella tularensis
Sequence length354
FASTA sequence>tr|A0A0E2ZJV3|A0A0E2ZJV3_FRATU Fructose-1,6-bisphosphate aldolase OS=Francisella tularensis GN=fba PE=3 SV=1 MALVSLRQLLDHAAEHGYGLPAFNVNNLEQVRAVMEAADKVNSPVILQGSAGARKYAGAS FIRHLVLAAIEEYPHIPVCMHQDHGTSPSVCQRSIQLGFSSVMMDGSLKSDGKTPADYEY NVNVTKTVSDMAHACGVSVEGELGCLGSLETGQAGEEDGIGAEGTLSMDQLLTDPEEAAD FVRRTKVDALAIAIGTSHGAYKFTKPPTGDVLSIKRVKEIHARIPDTHLVMHGSSSVPQD WLEVINTYGGAMGETYGVPVEEIVEAIKYSVRKINIDTDLRMAATGAIRRFLAENPAEFD PRKYNAVAKAAMSEICAARYEAFGSAGMASKIKPISLEIMFQRYESGELDPIVK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionFructose-1,6-bisphosphate aldolase
References for functionBozue, Joel A., et al. A Spontaneous Mutation in kdsD, a Biosynthesis Gene for 3-Deoxy-D-manno-Octulosonic Acid, Occurred in a Ciprofloxacin Resistant Strain of Francisella tularensis and Causes a High Level of
E.C. number4.1.2.13
Location of functional site(s)Active site: 83 Binding site: 199
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscription regulator
References for functionZiveri, Jason., et al. The metabolic enzyme fructose-1,6-bisphosphate aldolase acts as a transcriptional regulator in pathogenic Francisella. Nature Comm, 2017, (8): 853.
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Comments