Protein Information

General Information
MoonProt ID10
First appeared in release1.0
Name(s)6-phosphofructokinase Phosphofructokinase Phosphohexokinase pfkA
UniProt IDE6KMA1 (E6KMA1_STROR), Unreviewed
GO termsGO:0006002 fructose 6-phosphate metabolic process GO:0006096 glycolysis GO:0016310 phosphorylation GO:0000166 nucleotide binding GO:0003872 6-phosphofructokinase activity GO:0005524 ATP binding GO:0008443 phosphofructokinase activity GO:0016301 kinase activity GO:0016740 transferase activity GO:0046872 metal ion binding GO:0005737 cytoplasm GO:0005945 6-phosphofructokinase complex GO: 0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus oralis LA11 - oral streptococci
Sequence length335
FASTA sequence>gi|446743625|ref|WP_000820881.1| 6-phosphofructokinase [Streptococcus oralis] MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIYPLDAASVGDIISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWAGIATGADEIIIPEEGFKMEDIVASIKAGYEHGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGVAVGIRNEKMVENPILGTAEEGALFSLTADGKIVVNNPHKADLELSDLNKSLS
Structure Information
PDB IDclosest homologue with structure in the PDB has 62% amino acid sequence identity
Quaternary structure
Function 1
Function description6-phosphofructokinase, enzyme ATP + D-fructose 6-phosphate => ADP + D-fructose 1,6-bisphosphate Carbohydrate degradation, glycolysis
References for function
E.C. number2.7.1.11
Location of functional site(s)Active site:127 Binding site:154,162,244,11,222 Metal binding site:103 Nucleotide binding site:72-73,102-105
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds plasminogen from host organism
References for functionKinnby B, Booth NA, Svensater G. Plasminogen binding by oral streptococci from dental plaque and inflammatory lesions. Microbiology 2008; 154: 924931. PMID: 18310038
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments