Protein Information

General Information
MoonProt ID101
First appeared in release1.0
Name(s)Triose phosphate isomerase Triosephosphate isomerase TIM Triose-phosphate isomerase Gene Name: tpiA
UniProt IDE6J203 (E6J203_STRAP), Unreviewed
GO termsGO:0006094 gluconeogenesis GO:0006096 glycolysis GO:0006098 pentose-phosphate shunt GO:0008152 metabolic process GO:0003824 catalytic activity GO:0004807 triose-phosphate isomerase activity GO:0016853 isomerase activity GO:0005737 cytoplasm GO:0005515 protein binding
Organisms for which functions have been demonstratedStreptococcus - oral streptococci (S. anginosus and S. oralis)
Sequence length252
FASTA sequence>gi|333769664|gb|EGL46762.1| triose-phosphate isomerase [Streptococcus anginosus SK52 = DSM 20563] MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSDLKIAAENCYFEDAGAFTGENSPKVLAEMGTDYVVIGHSERREYFHETDEDINKKAHAIFRNGLLPIICCGESLETYEAGKAVEFVGAQVSAALKGLTAEQVSSLVIAYEPIWAIGTGKSATQDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPNNVAEYMACPDVDGALVGGASLEAESFLALLDFVK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionTriose phosphate isomerase, enzyme D-glyceraldehyde 3-phosphate <=> dihydroxyacetone phosphate Carbohydrate degradation, glycolysis Carbohydrate biosynthesis, gluconeogenesis
References for functionTakahashi, S., K. Abbe, and T. Yamada. "Purification of pyruvate formate-lyase from Streptococcus mutans and its regulatory properties." Journal of Bacteriology 149.3 (1982): 1034-1040.
E.C. number5.3.1.1
Location of functional site(s)Active site:168,96 Binding site:174,214
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionKinnby B, Booth NA, Svensater G. Plasminogen binding by oral streptococci from dental plaque and inflammatory lesions. Microbiology. 2008 Mar;154(Pt 3):924-31. doi: 10.1099/mic.0.2007/013235-0. PMID: 18310038
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments