Protein Information

General Information
MoonProt ID115
First appeared in release1.0
Name(s)L-lactate dehydrogenase B chain lactate dehydrogenase B Epsilon-crystallin LDH-B Gene Name: LDHB
UniProt IDP13743 (LDHB_ANAPL) Reviewed
GO termsGO: 0005975 carbohydrate metabolic process GO: 0006096 glycolysis GO: 0044262 cellular carbohydrate metabolic process GO: 0055114 oxidation-reduction process GO: 0003824 catalytic activity GO: 0004459 L-lactate dehydrogenase activity GO: 0005212 structural constituent of eye lens GO: 0016491 oxidoreductase activity GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO: 0005737 cytoplasm GO: 0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedAnas platyrhynchos (Mallard duck)
Sequence length333
FASTA sequence>sp|P13743|LDHB_ANAPL L-lactate dehydrogenase B chain OS=Anas platyrhynchos GN=LDHB PE=1 SV=2 MATLKEKLMTPVAAASAVPSSKITVVGVGQVGMACAVSILGKGLCDELALVDVLEDKLKGEMMDLQHGSLFLQTHKIVADKDYAVTANSKIVVVTAGVRQQEGESRLNLVQRNVGVFKGIIPQIVKYSPNCTILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDTARFRYLMAERLGIHPTSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPAMGTDKDSENWKEVHKQVVESAYEVIRLKGYTNWAIGLSVAELCETMLKNLCRVHSVSTLVKGTYGIENDVFLSLPCVLSASGLTSVINQKLKDDEVAQLKKSADTLWSIQKDLKDM
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionlactate dehydrogenase, enzyme lactate + NAD+ <=> pyruvate + NADH pyruvate fermentation to lactate
References for functionHendriks W., Mulders J.W.M., Bibby M.A., Slingsby C., Bloemendal H., de Jong W.W., Mulders JW., Bibby MA., de Jong WW. Duck lens epsilon-crystallin and lactate dehydrogenase B4 are identical: A single-copy gene product with two distinct functions. (1988) Pro. Natl. Acad. Sci. U.S.A. 85(19), 7114-8. Wistow G.J., Mulders J.W.M., de Jong W.W., The enzyme lactate dehydrogenase as a structural protein in avian and crocodilian lenses. (1987) Nature 326, 622-624.
E.C. number1.1.1.27
Location of functional site(s)Active site:193 Binding site:169,106,99,138,248 Nucleotide binding site:29-57
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionStructural eye lens protein (epsilon-crystallin)- also in crocodile, hummingbird, chimney swift
References for functionHendriks W., Mulders J.W.M., Bibby M.A., Slingsby C., Bloemendal H., de Jong W.W., Mulders JW., Bibby MA., de Jong WW. Duck lens epsilon-crystallin and lactate dehydrogenase B4 are identical: A single-copy gene product with two distinct functions. (1988) Pro. Natl. Acad. Sci. U.S.A. 85(19), 7114-8.PMID: 3174623 . Piatigorsky J. Multifunctional lens crystallins and corneal enzymes. More than meets the eye. (1998). Annals NY Academy Sci. 842(1), 2-15.PMID: 9599288. Wistow G.J., Mulders J.W.M., de Jong W.W., The enzyme lactate dehydrogenase as a structural protein in avian and crocodilian lenses. (1987) Nature 326, 622-624. PMID: 3561501
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of the eye
Comments