Protein Information

General Information
MoonProt ID116
First appeared in release1.0
Name(s)Iota-crystallin CRBPI crystallin cellular retinol binding protein 1
UniProt IDQ9I9A9 (Q9I9A9_9SAUR), Unreviewed
GO termsGO:0008289 lipid binding GO:0016918 retinal binding GO:0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedLygodactylus luteopicturatus (Yellow-headed Dwarf Gecko)
Sequence length128
FASTA sequence>tr|Q9I9A9|Q9I9A9_9SAUR Iota-crystallin (Fragment) OS=Lygodactylus luteopicturatus GN=CRBPI PE=2 SV=1 YYRFVSQDNMDNYLRVLDINVALRKLVCLLKPDKEIIHNGNHMTIRTLTTLRNYIMDFDLGTEFEEDLGPVDGRKCQTIVQWNGDKLVCEQHGEKKNRGWKQWLEGDFLHLHMSAEDETCIQIFEKIK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionCellular retinol-binding protein Type 1 carrier protein involved in transport of retinol from liver to peripheral tissues
References for functionWerten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7. PMID: 10725366
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptioncrystallin Ultraviolet Filter Lens protein
References for functionRoll B, Amons R, de Jong WW. (1996) Vitamin A2 bound to cellular retinol-binding protein as ultraviolet filter in the eye lens of the gecko Lygodactylus picturatus. J Biol Chem. 271:10437-40. PMID: 8631836. Werten PJL, Roll B, van Aalten DMF, de Jong WW. (2000) Gecko iota-crystallin: How cellular retinol-binding protein became an eye lens ultraviolet filter. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3282-7. PMID: 10725366.
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of eye
Comments