Protein Information

General Information
MoonProt ID117
First appeared in release1.0
Name(s)L-lactate dehydrogenase crystallin (upsilon) lactate dehydrogenase A
UniProt IDQ7YQK6 (Q7YQK6_ORNAN), Unreviewed
GO termsGO: 0005975 carbohydrate metabolic process GO: 0006096 glycolysis GO: 0044262 cellular carbohydrate metabolic process GO: 0055114 oxidation-reduction process GO: 0003824 catalytic activity GO: 0004459 L-lactate dehydrogenase activity GO: 0016491 oxidoreductase activity GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO: 0005737 cytoplasm GO: 0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedOrnithorhynchus anatinus (Duckbill platypus)
Sequence length332
FASTA sequence>tr|Q7YQK6|Q7YQK6_ORNAN L-lactate dehydrogenase OS=Ornithorhynchus anatinus PE=2 SV=1 MAGVKEQLIQNLLKEEYAPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGIHSTSCHGWVIGEHGDSSVPVWSGVNVAGVSLKNLHPDLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIVKNLRRVHPISTMIKGLYGIKDEVFLSVPCVLGQNGISDVVKITLKSEEEAHLKKSADTLWGIQKELQF
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionLactate dehydrogenase A, enzyme Fermentation, Pyruvate fermentation to lactate pyruvate + NADH <=> lactate + NAD+ Catalyzes the conversion of pyruvate (final product of glycolysis) to lactate
References for functionvan Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25. PMID: 12716980
E.C. number1.1.1.27
Location of functional site(s)Active site:193
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionLens protein crystallin
References for functionvan Rheede T, Amons R, Stewart N, de Jong WW. (2003) Lactate dehydrogenase A as a highly abundant eye lens protein in the platypus (Ornithorhynchus anatinus): upsilon crystallin. Mol Biol Evol. 2003 Jun;20(6):994-8. Epub 2003 Apr 25. PMID: 12716980
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of eye
Comments