Protein Information

General Information
MoonProt ID119
First appeared in release1.0
Name(s)Lambda-crystallin L-gulonate 3-dehydrogenase Gul3DH GDH Gene Name: CRYL1
UniProt IDP14755 (CRYL1_RABIT), Reviewed
GO termsGO:0006631 fatty acid metabolic process GO:0055114 oxidation-reduction process GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity GO:0005212 structural constituent of eye lens GO:0016491 oxidoreductase activity GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor GO:0042803 protein homodimerization activity GO:0050104 L-gulonate 3-dehydrogenase activity GO:0050662 coenzyme binding GO:0070403 NAD+ binding GO:0005737 cytoplasm GO:0005829 cytosol GO: 0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedOryctolagus cuniculus (Rabbit)
Sequence length319
FASTA sequence>sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 MASPAAGDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSSSSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGMKRVLKSFGSIPEFSGATVEKVNQAMCKKVPADPEHLAARREWRDECLKRLAKLKRQMQPQ
Structure Information
PDB ID3ADO, 3ADP
Quaternary structure
Function 1
Function descriptionL-gulonate 3 -dehydrogenase, enzyme L-gulonate + NAD(+) <=> 3-dehydro-L-gulonate + NADH Catalysis the NAD-linked dehydrogenation of L-gulonate into dehydro-L-gulonate in the urinate cycle.
References for functionStructural and functional characterization of rabbit and human L-gulonate 3-dehydrogenase. Ishikura S., Usami N., Araki M., Hara A. J. Biochem. 137:303-314(2005). PMID: 15809331. Dimeric crystal structure of rabbit L-gulonate 3-dehydrogenase/lambda-crystallin: insights into the catalytic mechanism. Asada Y, Kuroishi C, Ukita Y, Sumii R, Endo S, Matsunaga T, Hara A, Kunishima N.J Mol Biol. 2010 Sep 3;401(5):906-20. doi: 10.1016/j.jmb.2010.06.069. Epub 2010 Jul 8. PMID: 20620150.
E.C. number1.1.1.45
Location of functional site(s)Binding site:97,36,102 Nucleotide binding site:16-17
Cellular location of functionMitochondria
Comments
Function 2
Function descriptionLambda crystallin
References for functionLambda-crystallin, a major rabbit lens protein, is related to hydroxyacyl-coenzyme A dehydrogenases. Mulders J.W.M., Hendriks W., Blankesteijn W.M., Bloemendal H., de Jong W.W. J. Biol. Chem. 263:15462-15466(1988). PMID: 3170592.
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of the eye
Comments