Protein Information

General Information
MoonProt ID120
First appeared in release1.0
Name(s)Quinone oxidoreductase NADPH:quinone reductase Zeta-crystallin Gene Name: CRYZ
UniProt IDP11415 (QOR_CAVPO) Reviewed
GO termsGO:0042178 xenobiotic catabolic process GO:0051289 protein homotetramerization GO:0055114 oxidation-reduction process GO:0003723 RNA binding GO:0003730 mRNA 3'-UTR binding GO:0003960 NADPH:quinone reductase activity GO:0005212 structural constituent of eye lens GO:0008270 zinc ion binding GO:0016491 oxidoreductase activity GO:0070402 NADPH binding GO:0070404 NADH binding GO:0005737 cytoplasm GO:0005794 Golgi apparatus GO:0005829 cytosol GO:0043231 intracellular membrane-bounded organelle GO: 0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedCavia porcellus (Guinea pig)
Sequence length329
FASTA sequence>sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 MATGQKLMRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVAGVVESIGNDVSAFKKGDRVFTTSTISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIEINPRDTMAKESTISGVSLFSSTKEEFQQFASTIQAGMELGWVKPVIGSQYPLEKASQAHENIIHSSGTVGKTVLLM
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionQuinone oxidoreductase NADPH:quinone oxidoreductase NADPH + 2 quinone <=> NADP(+) + 2 semiquinone
References for functionIdentification and characterization of the enzymatic activity of zeta-crystallin from guinea pig lens. A novel NADPH:quinone oxidoreductase. Rao P.V., Krishna C.M., Zigler J.S. Jr.J. Biol. Chem. 267:96-102(1992). PMID: 1370456. Zeta-crystallin from guinea pig lens is capable of functioning catalytically as an oxidoreductase. Rao, P. V., and Zigler, J. S., Jr. (1990) Biochem. Biophys. Res. Commun. 167,1221-1228. PMID: 1989495
E.C. number1.6.5.5
Location of functional site(s)Binding site:229,53,181,200 Nucleotide binding site:158-161,246-249,269-271
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionZeta-crystallin (Also in camels, llamas, and tree frog)
References for functionZeta-crystallin, a novel lens protein from the guinea pig. Huang QL, Russell P, Stone SH, Zigler JS Jr. Curr Eye Res. 1987 May;6(5):725-32. PMID: 3595182
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of the eye
Comments