Protein Information

General Information
MoonProt ID121
First appeared in release1.0
Name(s)Zeta-crystallin NADPH:quinone oxidoreductase
UniProt IDQ98TD4 (Q98TD4_HYLJA) Unreviewed
GO termsGO:0055114 oxidation-reduction process GO:0008270 zinc ion binding GO:0016491 oxidoreductase activity GO: 0005212 structural constituent of eye lens
Organisms for which functions have been demonstratedHyla japonica (Japanese tree frog)
Sequence length329
FASTA sequence>tr|Q98TD4|Q98TD4_HYLJA Zeta-crystallin OS=Hyla japonica PE=2 SV=1 MASVDRFMRAIRVNEFGKPDVLKLMTDVPVPSPGENQVLIRVHACGINPFESYIRSGLFAWRPSLPYTPGSDTSGVVEAVGRNVTGFKKGDRVFTRSTITGGYAEYTVACEDMVYHLPDHLNFKQGAALAIPYFTAYRALFQKAHAKPGELILIHGASGGVGIAACQLARAYGFKVFGTAGTPKGLNLVMQNGAHKVFNHREKDYIEKIQEAAGGEGVDVILEMLANCNLCNDLKLLSYGGRVVVLGSQGSVDINPTDIIAKETSIIGHSLYSSTKEEWKEARAAIFGGMESGWLKPLIGPEYPLEKASQAHEDLTQDSGATGKMVLVL
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionNADPH:quinone oxidoreductase, enzyme
References for function
E.C. number1.6.99.2
Location of functional site(s)
Cellular location of function
Comments
Function 2
Function descriptionZeta crystallin (Also in camel, llamas and Guinea pig)
References for functionTaxon-specific zeta-Crystallin in Japanese Tree Frog (Hyla japonica) Lens. Fujii Y., Kimoto H., Ishikawa K., Watanabe K., Yokota Y., Nakai N., Taketo A. J Biol Chem. 2001 Jul 27;276(30):28134-9. Epub 2001 May 22. PMID: 11371565
E.C. numberN/A
Location of functional site(s)
Cellular location of functionlens of the eye
Comments