Protein Information

General Information
MoonProt ID122
First appeared in release1.0
Name(s)Pterin-4-alpha-carbinolamine dehydratase PHS 4-alpha-hydroxy-tetrahydropterin dehydratase, Dimerization cofactor of hepatocyte nuclear factor 1-alpha DCoH Dimerization cofactor of HNF1? Phenylalanine hydroxylase-stimulating protein Pterin carbinolamine dehydratase PCD Dcoh Pcbd Gene Name: Pcbd1
UniProt IDP61459 (PHS_RAT), Reviewed
GO termsGO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0006558 L-phenylalanine metabolic process GO:0006729 tetrahydrobiopterin biosynthetic process GO:0008150 biological_process GO:0043496 regulation of protein homodimerization activity GO:0045893 positive regulation of transcription, DNA-templated GO:0051289 protein homotetramerization GO:0051291 protein heterooligomerization GO:0055114 oxidation-reduction process GO:0003674 molecular_function GO:0003713 transcription coactivator activity GO:0004505 phenylalanine 4-monooxygenase activity GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity GO:0016829 lyase activity GO:0042802 identical protein binding GO:0005575 cellular_component GO:0005634 nucleus GO:0005737 cytoplasm GO:0008134 transcription factor binding GO:0005515 protein binding
Organisms for which functions have been demonstratedRattus norvegicus
Sequence length104
FASTA sequence>gi|47606443|sp|P61459.2|PHS_RAT RecName: Full=Pterin-4-alpha-carbinolamine dehydratase; Short=PHS; AltName: Full=4-alpha-hydroxy-tetrahydropterin dehydratase; AltName: Full=Dimerization cofactor of hepatocyte nuclear factor 1-alpha; Short=DCoH; Short=Dimerization cofactor of HNF1; AltName: Full=Phenylalanine hydroxylase-stimulating protein; AltName: Full=Pterin carbinolamine dehydratase; Short=PCD MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Structure Information
PDB ID1DCH 1DCP 1F93(with binding partner)
Quaternary structure
Function 1
Function descriptionPterin-4-alpha-carbinolamine dehydratase, enzyme convert 4a-hydroxy tetrahydropterin to quinonoid dihydrobiopterin, in phenylalanine hydroxylation reaction (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4a-hydroxypterin => (6R)-6-(L-erythro-1,2-dihydroxypropyl)-7,8-dihydro-6H-pterin + H2O
References for functionTakeuchi, Keisuke, et al. "A genome-wide survey of genes for enzymes involved in pigment synthesis in an ascidian, Ciona intestinalis." Zoological science 22.7 (2005): 723-734.
E.C. number4.2.1.96
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiondimerization of hepatocyte nuclear factor 1? (HNF1A), a homeodomain transcription factor, results in transcription activation
References for functionCitron BA, Davis MD, Milstien S, Gutierrez J, Mendel DB, Crabtree GR, Kaufman S. Identity of 4a-carbinolamine dehydratase, a component of the phenylalanine hydroxylation system, and DCoH, a transregulator of homeodomain proteins. Proc Natl Acad Sci U S A. 1992 Dec 15. PMID: 1465414
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments