Protein Information

General Information
MoonProt ID124
First appeared in release1.0
Name(s)Periplasmic serine endoprotease DegP Heat shock protein DegP Protease Do htrA ptd Gene Name: degP
UniProt IDP0C0V0 (DEGP_ECOLI), Reviewed
GO termsGO:0006457 protein folding GO:0006508 proteolysis GO:0006515 misfolded or incompletely synthesized protein catabolic process GO:0006950 response to stress GO:0006979 response to oxidative stress GO:0009266 response to temperature stimulus GO:0003824 catalytic activity GO:0004252 serine-type endopeptidase activity GO:0005515 protein binding GO:0008233 peptidase activity GO:0008236 serine-type peptidase activity GO:0016787 hydrolase activity GO:0042802 identical protein binding GO:0005886 plasma membrane GO:0016020 membrane GO:0030288 outer membrane-bounded periplasmic space GO:0061077 chaperone-mediated protein folding
Organisms for which functions have been demonstratedEscherichia coli (strain K12)
Sequence length474
FASTA sequence>sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Structure Information
PDB ID3OTP 4A8D 3MH4 3MH5
Quaternary structure
Function 1
Function descriptionpeptidase at higher temperatures.
References for functionKrojer, Tobias et. al. "Crystal Structure of DegP (HtrA) Reveals a New Protease-chaperone Machine." Max-Planck-Institut fur Biochemie, Abteilung Strukturforschung, Germany. Cardiff University, School of Biosciences, Museum Avenue, Cardiff CF10 3US. PMID: 11919638
E.C. number3.4.21.107
Location of functional site(s)Active site:161,131,236 Binding site:161,58,131
Cellular location of function
Comments
Function 2
Function descriptionchaperone at low temperatures
References for functionKrojer, Tobias et. al. "Crystal Structure of DegP (HtrA) Reveals a New Protease-chaperone Machine." Max-Planck-Institut fur Biochemie, Abteilung Strukturforschung, Germany. Cardiff University, School of Biosciences, Museum Avenue, Cardiff CF10 3US. PMID: 11919638
E.C. numberN/A
Location of functional site(s)
Cellular location of function
Comments