Protein Information

General Information
MoonProt ID145
First appeared in release1.0
Name(s)glutamate racemase Gene Name: murI
UniProt IDP9WPW9
GO termsGO:0006807 nitrogen compound metabolic process GO:0008152 metabolic process GO:0008360 regulation of cell shape GO:0009252 peptidoglycan biosynthetic process GO:0008881 glutamate racemase activity GO:0016853 isomerase activity GO:0016855 racemase and epimerase activity, acting on amino acids and derivatives GO:0036361 racemase activity, acting on amino acids and derivatives GO:0003677 DNA binding GO:0006265 DNA topological change
Organisms for which functions have been demonstratedMycobacterium tuberculosis
Sequence length271
FASTA sequence>sp|P9WPW9|MURI_MYCTU Glutamate racemase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=murI PE=1 SV=1 MNSPLAPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPEIRAHALAIG DDLVGRGVKALVIACNSASSACLRDARERYQVPVVEVILPAVRRAVAATRNGRIGVIGTR ATITSHAYQDAFAAARDTEITAVACPRFVDFVERGVTSGRQVLGLAQGYLEPLQRAEVDT LVLGCTHYPLLSGLIQLAMGENVTLVSSAEETAKEVVRVLTEIDLLRPHDAPPATRIFEA TGDPEAFTKLAARFLGPVLGGVQPVHPSRIH
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionglutamate racemase L-glutamate <=> D-glutamate Cell wall biogenesis, peptidoglycan biosynthesis
References for functionSengupta, Sugopa, Soumitra Ghosh, and Valakunja Nagaraja. "Moonlighting function of glutamate racemase from Mycobacterium tuberculosis: racemization and DNA gyrase inhibition are two independent activities of the enzyme." Microbiology 154.9 (2008): 2796-2803.
E.C. number5.1.1.3
Location of functional site(s)Active site:75,185
Cellular location of function
Comments
Function 2
Function descriptionDNA gyrase relieves strain when double-stranded DNA is being unwound
References for functionAshiuchi M, Kuwana E, Komatsu K, Soda K, Misono H. Differences in effects on DNA gyrase activity between two glutamate racemases of Bacillus subtilis, the poly-gamma-glutamate synthesis-linking Glr enzyme and the YrpC (MurI) isozyme. FEMS Microbiol Lett. 2003 Jun 27. PMID: 12829290. Ashiuchi M, Kuwana E, Yamamoto T, Komatsu K, Soda K, Misono H. Glutamate racemase is an endogenous DNA gyrase inhibitor. J Biol Chem. 2002 Oct 18. PMID: 12213801.
E.C. number5.99.1
Location of functional site(s)
Cellular location of functionwith DNA
Comments