Protein Information

General Information
MoonProt ID151
First appeared in release1.0
Name(s)folate receptor FRalpha Folate receptor alpha FR-alpha Folate receptor 1 Folate-binding protein 1 Gene Name:Folr1
UniProt IDP35846 (FOLR1_MOUSE), Reviewed
GO termsGO:0006620 posttranslational protein targeting to membrane GO:0006810 transport GO:0015884 folic acid transport GO:0046655 folic acid metabolic process GO:0004872 receptor activity GO:0005542 folic acid binding GO:0008517 folic acid transporter activity GO:0005576 extracellular region GO:0005768 endosome GO:0005886 plasma membrane GO:0016020 membrane GO:0016023 cytoplasmic membrane-bounded vesicle GO:0016324 apical plasma membrane GO:0030136 clathrin-coated vesicle GO:0031225 anchored component of membrane GO:0031362 anchored component of external side of plasma membrane GO:0031410 cytoplasmic vesicle GO:0003677 DNA binding GO:0006351 transcription, DNA templated GO:0003677 DNA binding GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedMus musculus
Sequence length255
FASTA sequence>gi|357527376|ref|NP_001239483.1| folate receptor alpha precursor [Mus musculus] MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionfolate receptor binds folate and derivatives and brings them into the cell during endocytosis
References for function
E.C. numberN/A
Location of functional site(s)Binding site:105,101,194
Cellular location of functioncell surface, endocytic vesicles
Comments
Function 2
Function descriptiontranscription factor
References for functionBoshnjaku V, Shim KW, Tsurubuchi T, Ichi S, Szany EV, Xi G, ManiaFarnell B, McLone DG, Tomita T, Mayanil CS. Nuclear localization of folate receptor alpha: a new role as a transcription factor. Sci Rep. 2012 0. PMID: 23243496
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments