Protein Information

General Information
MoonProt ID153
First appeared in release1.0
Name(s)Aaa autolysin N-acetylmuramoyl-L-alanine amidase sle1 Gene Name: sle1
UniProt IDQ2YVT4 (SLE1_STAAB) Reviewed
GO termsGO:0000917 barrier septum assembly GO:0007049 cell cycle GO:0008152 metabolic process GO:0009405 pathogenesis GO:0016998 cell wall macromolecule catabolic process GO:0019835 cytolysis GO:0042742 defense response to bacterium GO:0051301 cell division GO:0003824 catalytic activity GO:0008745 N-acetylmuramoyl-L-alanine amidase activity GO:0016787 hydrolase activity GO:0005576 extracellular region GO:0009986 cell surface GO:0005515 protein binding GO:0098631 cell adhesion madiator activity
Organisms for which functions have been demonstratedStaphylococcus aureus
Sequence length334
FASTA sequence>gi|447092998|ref|WP_001170254.1| N-acetylmuramoyl-L-alanine amidase [Staphylococcus aureus] MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSNLIFPNQVLKVSGSSNSTINSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNGLNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQKIMSLNGLNNFFIYPGQKLKVTGNATSSNSASATTTNRGYNTPVFSHQNLYTWGQCTYHVFNRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNNDGSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionAaa autolysin peptidoglycan hydrolase, enzyme in cell division, cell separation, and cell wall turnover also bacteriolytic activity cleaves some cell wall glycopeptides, hydrolyzes the link between L-amino acid residues and N-acetylmuramoyl residues
References for functionHeilmann C, Thumm G, Chhatwal GS, Hartleib J, Uek?tter A, Peters G. Identification and characterization of a novel autolysin (Aae) with adhesive properties from Staphylococcus epidermidis. Microbiology. 2003 Oct. PMID: 14523110
E.C. number3.5.1.28
Location of functional site(s)
Cellular location of functioncell surface
Comments
Function 2
Function descriptionfibronectin binding, adhesin
References for functionHeilmann C, Hartleib J, Hussain MS, Peters G. The multifunctional Staphylococcus aureus autolysin aaa mediates adherence to immobilized fibrinogen and fibronectin. Infect Immun. 2005 Aug. PMID: 16040992 Heilmann C, Thumm G, Chhatwal GS, Hartleib J, Uek?tter A, Peters G. Identification and characterization of a novel autolysin (Aae) with adhesive properties from Staphylococcus epidermidis. Microbiology. 2003 Oct. PMID: 14523110
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments