Protein Information

General Information
MoonProt ID157
First appeared in release1.0
Name(s)Ag85B antigen 85 (Ag85) complex FbpB protein Gene Name: fbpB
UniProt IDP9WQP1
GO termsGO:0001968 fibronectin binding GO:0004144 diacylglycerol O-acyltransferase activity GO:0005515 protein binding GO:0016740 transferase activity GO:0005515 protein binding GO:0098631 cell adhesion mediator
Organisms for which functions have been demonstratedMycobacterium tuberculosis
Sequence length
FASTA sequence>sp|P9WQP1|A85B_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fbpB PE=1 SV=1 MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionmycolyltransferase, enzyme cell wall assembly Transesterification of mycolic acids
References for functionBelisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS. Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30. PMID: 9162010
E.C. number
Location of functional site(s)Active site:270,302,166 Binding site:279,166,194
Cellular location of functionsecreted
Comments
Function 2
Function descriptionfibronectin binding
References for functionWiker HG, Sletten K, Nagai S, Harboe M. Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan. PMID: 2403534
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments