Protein Information

General Information
MoonProt ID158
First appeared in release1.0
Name(s)Ag85C antigen 85 (Ag85) complex FbpC protein Gene Name: fbpC
UniProt IDP9WQN9
GO termsGO:0004144 diacylglycerol O-acyltransferase activity GO:0016740 transferase activity GO:0035375 zymogen binding GO:0050348 trehalose O-mycolytransferase activity GO:0006869 lipid transport GO:0009247 glycolipid biosynthetic process GO:0071769 mycolate cell wall layer assembly GO:0005576 extracellular region GO:0005515 protein binding GO:0098631 cell adhesion mediator activity
Organisms for which functions have been demonstratedMycobacterium tuberculosis
Sequence length340 aa
FASTA sequence>sp|P9WQN9|A85C_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fbpC PE=1 SV=1 MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionmycolyltransferase, enzyme cell wall assembly Transesterification of mycolic acids
References for functionBelisle JT, Vissa VD, Sievert T, Takayama K, Brennan PJ, Besra GS. Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science. 1997 May 30. PMID: 9162010
E.C. number
Location of functional site(s)Active site:170,306,274 Binding site:170,198,283
Cellular location of functionsecreted
Comments
Function 2
Function descriptionfibronectin binding
References for functionWiker HG, Sletten K, Nagai S, Harboe M. Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex. Infect Immun. 1990 Jan. PMID: 2403534
E.C. numberN/A
Location of functional site(s)
Cellular location of functionsecreted
Comments