Protein Information

General Information
MoonProt ID159
First appeared in release1.0
Name(s)thioredoxin Gene Name:trxA
UniProt IDD3QX74 (D3QX74_ECOCB), Unreviewed
GO termsGO:0006662 glycerol ether metabolic process GO:0045454 cell redox homeostasis GO:0055114 oxidation-reduction process GO:0015035 protein disulfide oxidoreductase activity GO:0005515 protein binding GO:0098631 cell adhesion mediator activity
Organisms for which functions have been demonstratedEscherichia coli
Sequence length127
FASTA sequence>tr|D3QX74|D3QX74_ECOCB Thioredoxin OS=Escherichia coli O55:H7 (strain CB9615 / EPEC) GN=trxA PE=3 SV=1 MLHQQRNQHARLIPVELYMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Structure Information
PDB ID3DXB, 2TRX, 1T7P, 1SKR, 1SKS, 1SKW, 1SL0, 1SL1, 1SL2, 1TK0, 1TK5, 1TK8, 1TKD, 1T8E, 1X9M, 1X9S, 1X9W, 2BTO, 1ZYQ, 2AJQ, 2H6X, 1ZZY, 3DYR, 2H76, 2H71, 2H75, 2H70, 2H74, 2H73, 2TIR, 2H6Z, 2H72, 2H6Y, 2FCH
Quaternary structure
Function 1
Function descriptionthioredoxin antioxidant aids the reduction of other proteins by cysteine thiol-disulfide exchange
References for functionLaurent, Torvard C., E. Colleen Moore, and Peter Reichard. "Enzymatic synthesis of deoxyribonucleotides IV. Isolation and characterization of thioredoxin, the hydrogen donor from Escherichia coli B." Journal of Biological Chemistry 239.10 (1964): 3436-3444.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionSubunit of T7 DNA polymerase ****maybe not strictly considered moonlighting because adopted by a phage to be part of a protein complex*****
References for functionMark DF, Richardson CC. Escherichia coli thioredoxin: a subunit of bacteriophage T7 DNA polymerase. Proc Natl Acad Sci U S A. 1976 Mar. PMID: 768986
E.C. numberN/A
Location of functional site(s)
Cellular location of functionbinding to DNA
Comments