Protein Information

General Information
MoonProt ID16
First appeared in release1.0
Name(s)aspartate ammonia lyase aspartase Gene Name: aspA
UniProt IDP44324 (ASPA_HAEIN), Reviewed
GO termsGO:0006099 tricarboxylic acid cycle GO:0006531 aspartate metabolic process GO: 0005515 protein binding GO:0003824 catalytic activity GO:0008797 aspartate ammonia-lyase activity GO:0016829 lyase activity
Organisms for which functions have been demonstratedHaemophilus influenzae strain HI-23459
Sequence length475
FASTA sequence>gi|1168534|sp|P44324.1|ASPA_HAEIN RecName: Full=Aspartate ammonia-lyase; Short=Aspartase MITMTQFRKEVDLLGERDVPAEAYWGIHTLRAVENFNISNVTISDVPEFVRGMVMVKKATALANGELGAIPSDIAKAIVAACDEILTTGKCLDQFPSDVYQGGAGTSVNMNTNEVVANLALEKIGHKKGEYNVINPMDHVNASQSTNDAYPTGFRIAVYNSILKLIDKIQYLHDSFDNKAKEFANILKMGRTQLQDAVPMTVGQEFKAFAVLLEEEVRNLKRTAGLLLEVNLGATAIGTGLNTPQGYTELVVKHLAEVTGLACVPAENLIEATSDCGAYVMVHGALKRTAVKLSKVCNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTFASEAGQLQLNVMEPVIGQAMFESIDILTNACVNLRDKCVDGITVNKEICENYVFNSIGIVTYLNPFIGHHNGDLVGKICAQTGKGVREVVLEKGLLTEEQLDDILSVENLMNPTYKAKLNK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionaspartate ammonia lyase, aspartase, enzyme L-aspartate => fumarate + NH3
References for functionDemonstrated aspartase activity of purified protein: Sjstrm I, Grndahl H, Falk G, Kronvall G, Ullberg M.Biochim Biophys Acta. 1997 Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Mar 13;1324(2):182-90. PMID: 9092705
E.C. number4.3.1.1
Location of functional site(s)Binding site:106
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds plasminogen
References for functionDemonstrated aspartase activity of purified protein: Sjstrm I, Grndahl H, Falk G, Kronvall G, Ullberg M.Biochim Biophys Acta. 1997 Purification and characterisation of a plasminogen-binding protein from Haemophilus influenzae. Sequence determination reveals identity with aspartase. Mar 13;1324(2):182-90. PMID: 9092705
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments