Protein Information

General Information
MoonProt ID164
First appeared in release1.0
Name(s)Glutamate dehydrogenase RocG Catabolic NAD-specific glutamate dehydrogenase RocG NAD-GDH GlutDH Trigger enzyme RocG Gene Name:rocG
UniProt IDP39633 (DHE2_BACSU) Reviewed
GO termsGO:0006520 cellular amino acid metabolic process GO:0055114 oxidation-reduction process GO:0004352 glutamate dehydrogenase (NAD+) activity GO:0005515 protein binding GO:0016491 oxidoreductase activity GO:0016639 oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor GO:0005515 protein binding GO:0008134 transcription factor binding GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedBacillus subtilis
Sequence length424
FASTA sequence>gi|349596655|gb|AEP92842.1| glutamate dehydrogenase [Bacillus subtilis subsp. subtilis str. RO-NN-1] MSAKQVSKDEEKEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEEVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKECDILVPAAISNQITAKNAHNIQASIVVEAANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGWV
Structure Information
PDB ID3K92
Quaternary structure
Function 1
Function descriptionglutamate dehydrogenase deaminates glutamate to form ?-ketoglutarate L-glutamate + H2O + NAD+ => 2-oxoglutarate + NH3 + NADH.
References for functionGunka K, Newman JA, Commichau FM, Herzberg C, Rodrigues C, Hewitt L, Lewis RJ, St?lke J. Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties. J Mol Biol. 2010 Jul 23. PMID: 20630473
E.C. number1.4.1.2
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptioninteracts directly with GltC, a LysR-type transcription factor
References for functionGunka K, Newman JA, Commichau FM, Herzberg C, Rodrigues C, Hewitt L, Lewis RJ, St?lke J. Functional dissection of a trigger enzyme: mutations of the bacillus subtilis glutamate dehydrogenase RocG that affect differentially its catalytic activity and regulatory properties. J Mol Biol. 2010 Jul 23. PMID: 20630473
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnear DNA
Comments