Protein Information

General Information
MoonProt ID165
First appeared in release1.0
Name(s)High mobility group protein B1 Amphoterin Heparin-binding protein p30 High mobility group protein 1 HMG-1 Gene Name:Hmgb1
UniProt IDP63159 (HMGB1_RAT), Reviewed
GO termsGO:0000902 cell morphogenesis GO:0002053 positive regulation of mesenchymal cell proliferation GO:0006935 chemotaxis GO:0007399 nervous system development GO:0007623 circadian rhythm GO:0008156 negative regulation of DNA replication GO:0008284 positive regulation of cell proliferation GO:0009408 response to heat GO:0009749 response to glucose GO:0010942 positive regulation of cell death GO:0010976 positive regulation of neuron projection development GO:0014911 positive regulation of smooth muscle cell migration GO:0030335 positive regulation of cell migration GO:0031175 neuron projection development GO:0031532 actin cytoskeleton reorganization GO:0032392 DNA geometric change GO:0032496 response to lipopolysaccharide GO:0032868 response to insulin GO:0000400 four-way junction DNA binding GO:0000401 open form four-way junction DNA binding GO:0000402 crossed form four-way junction DNA binding GO:0003677 DNA binding GO:0003681 bent DNA binding GO:0003690 double-stranded DNA binding GO:0003697 single-stranded DNA binding GO:0005125 cytokine activity GO:0005515 protein binding GO:0008097 5S rRNA binding GO:0008134 transcription factor binding GO:0008201 heparin binding GO:0008301 DNA binding, bending GO:0042277 peptide binding GO:0046983 protein dimerization activity GO:0050786 RAGE receptor binding GO:0051861 glycolipid binding GO:0033034 positive regulation of myeloid cell apoptotic process GO:0034341 response to interferon-gamma GO:0042493 response to drug GO:0043065 positive regulation of apoptotic process GO:0045663 positive regulation of myoblast differentiation GO:0045931 positive regulation of mitotic cell cycle GO:0050727 regulation of inflammatory response GO:0050831 male-specific defense response to bacterium GO:0050930 induction of positive chemotaxis GO:0051450 myoblast proliferation GO:0071347 cellular response to interleukin-1 GO:0005615 extracellular space GO:0005634 nucleus GO:0005694 chromosome GO:0005737 cytoplasm GO:0003677 DNA binding
Organisms for which functions have been demonstratedRattus norvegicus (Rat)
Sequence length215
FASTA sequence>sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Structure Information
PDB ID2YRQ, 2RTU
Quaternary structure
Function 1
Function descriptionbinds heparin involved in extension of neurite-type cytoplasmic processes
References for functionMerenmies J, Pihlaskari R, Laitinen J, Wartiovaara J, Rauvala H. 30-kDa heparin-binding protein of brain (amphoterin) involved in neurite outgrowth. Amino acid sequence and localization in the filopodia of the advancing plasma membrane. J Biol Chem. 1991 Sep 5. PMID: 1885601
E.C. numberN/A
Location of functional site(s)DNA binding site:95-163,9-79 Other functional site:67-68,10-11
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionDNA binding protein, without sequence specificity associates with chromatin, may play structural role bends DNA
References for functionHardman CH, Broadhurst RW, Raine AR, Grasser KD, Thomas JO, Laue ED. Structure of the A-domain of HMG1 and its interaction with DNA as studied by heteronuclear three- and four-dimensional NMR spectroscopy. Biochemistry. 1995 Dec 26. PMID: 8527432
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments