Protein Information

General Information
MoonProt ID166
First appeared in release1.0
Name(s)Arg82 Inositol polyphosphate multikinase IPMK Ipk2 Arginine metabolism regulation protein III Gene Name:ARG82
UniProt IDP07250 (IPMK_YEAST), Reviewed
GO termsGO:0000122 negative regulation of transcription from RNA polymerase II promoter GO:0000821 regulation of arginine metabolic process GO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0006525 arginine metabolic process GO:0016310 phosphorylation GO:0032958 inositol phosphate biosynthetic process GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0046854 phosphatidylinositol phosphorylation GO:0050821 protein stabilization GO:0000166 nucleotide binding GO:0000823 inositol-1,4,5-trisphosphate 6-kinase activity GO:0000824 inositol tetrakisphosphate 3-kinase activity GO:0000825 inositol tetrakisphosphate 6-kinase activity GO:0000827 inositol-1,3,4,5,6-pentakisphosphate kinase activity GO:0005524 ATP binding GO:0008440 inositol-1,4,5-trisphosphate 3-kinase activity GO:0016301 kinase activity GO:0016740 transferase activity GO:0030674 protein binding, bridging GO:0035004 phosphatidylinositol 3-kinase activity GO:0046872 metal ion binding GO:0005634 nucleus GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length355
FASTA sequence>sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1 MDTVNNYRVLEHKAAGHDGTLTDGDGLLIFKPAFPQELEFYKAIQVRDVSRRKSSADGDAPLCSWMPTYLGVLNEGAKIEQSGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYLVLENLLYGFSKPNILDIKLGKTLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKIQKNPSVLNQLSLEYYEEEADSDYIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKRLQLFYNTMLEEEVRMISSSLLFIYEGDPERWELLNDVDKLMRDDFIDDDDDDDDNDDDDDDDAEGSSEGPKDKKTTGSLSSMSLIDFAHSEITPGKGYDENVIEGVETLLDIFMKF
Structure Information
PDB ID2IEW, 2IF8
Quaternary structure
Function 1
Function descriptionkinase, enzyme phosphorylates inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) and inositol 1,3,4,5-tetrakisphosphate (Ins(1,3,4,5)P4) 2 ATP + 1D-myo-inositol 1,4,5-trisphosphate => 2 ADP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate.
References for functionHolmes W, Jogl G. Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity. J Biol Chem. 2006 Dec 8. PMID: 17050532. Saiardi A, ErdjumentBromage H, Snowman AM, Tempst P, Snyder SH. Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases. Curr Biol. 1999 Nov 18. PMID: 10574768. Odom AR, Stahlberg A, Wente SR, York JD. A role for nuclear inositol 1,4,5-trisphosphate kinase in transcriptional control. Science. 2000 Mar 17. PMID: 10720331.
E.C. number2.7.1.151
Location of functional site(s)Metal binding site:271,274,133,334,325
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionstabilizes transcription factors ARG80 and MCM1
References for functionEl Bakkoury, Dubois E, Messenguy F. Recruitment of the yeast MADS-box proteins, ArgRI and Mcm1 by the pleiotropic factor ArgRIII is required for their stability. Mol Microbiol. 2000 Jan. PMID: 10632874.
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments