Protein Information

General Information
MoonProt ID168
First appeared in release1.0
Name(s)Syntaxin-2 Epimorphin Gene Name:STX2
UniProt IDP32856 (STX2_HUMAN), Reviewed
GO termsGO:0006886 intracellular protein transport GO:0007165 signal transduction GO:0007340 acrosome reaction GO:0007398 ectoderm development GO:0009887 organ morphogenesis GO:0016192 vesicle-mediated transport GO:0030154 cell differentiation GO:0005484 SNAP receptor activity GO:0005515 protein binding GO:0048306 calcium-dependent protein binding GO:0005911 cell-cell junction GO:0009986 cell surface GO:0016020 membrane GO:0016021 integral component of membrane GO:0016323 basolateral plasma membrane GO:0031410 cytoplasmic vesicle GO:0043231 intracellular membrane-bounded organelle GO:0045121 membrane raft GO:0061025 membrane fusion GO:0006886 intracellular protein transport GO:0016192 vesicle-mediated transport
Organisms for which functions have been demonstratedHomo sapiens
Sequence length288
FASTA sequence>sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=1 SV=3 MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionepimorphin - mediates epithelial tissue morphogenesis outside the cell
References for functionHirai, Y., Bissell, M. J. & Radisky, D. C. Extracellular localization of epimorphin/syntaxin?2. Blood 110, 3082 (2007). PMID: 17916751
E.C. numberN/A
Location of functional site(s)
Cellular location of functionextracellular cell surface and secreted
Comments
Function 2
Function descriptionsyntaxin 2 controls protein secretion from endoplasmic reticulumGolgi-derived vesicles it is a target SNARE (t-SNARE) on the cytoplasmic side of the plasma membranes that aids in fusion of the plasma membrane with vesicles that carry the appropriate vesicle SNARE (v-SNARE) proteins
References for functionJahn R, Scheller RH. SNAREs: engines for membrane fusion. Nat Rev Mol Cell Biol (2006) 7:631-643. 16912714
E.C. numberN/A
Location of functional site(s)
Cellular location of functionintracellular surface of plasma membrane
Comments