Protein Information

General Information
MoonProt ID170
First appeared in release1.0
Name(s)Extracellular signal-regulated kinase 2 ERK-2 MAP kinase isoform p42 p42-MAPK Mitogen-activated protein kinase 2 MAP kinase 2 MAPK 2 Gene Name: MAPK1
UniProt IDP28482 (MK01_HUMAN), Reviewed
GO termsGO:0000165 MAPK cascade GO:0000186 activation of MAPKK activity GO:0000187 activation of MAPK activity GO:0000189 MAPK import into nucleus GO:0002224 toll-like receptor signaling pathway GO:0002755 MyD88-dependent toll-like receptor signaling pathway GO:0002756 MyD88-independent toll-like receptor signaling pathway GO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0006468 protein phosphorylation GO:0006915 apoptotic process GO:0006935 chemotaxis GO:0006950 response to stress GO:0006974 cellular response to DNA damage stimulus GO:0007049 cell cycle GO:0007165 signal transduction GO:0007173 epidermal growth factor receptor signaling pathway GO:0007264 small GTPase mediated signal transduction GO:0007265 Ras protein signal transduction GO:0007268 synaptic transmission GO:0007411 axon guidance GO:0007596 blood coagulation GO:0008284 positive regulation of cell proliferation GO:0008286 insulin receptor signaling pathway GO:0008543 fibroblast growth factor receptor signaling pathway GO:0009636 response to toxic substance GO:0009887 organ morphogenesis GO:0010800 positive regulation of peptidyl-threonine phosphorylation GO:0016032 viral process GO:0016310 phosphorylation GO:0016310 phosphorylation GO:0018105 peptidyl-serine phosphorylation GO:0018107 peptidyl-threonine phosphorylation GO:0019233 sensory perception of pain GO:0019858 cytosine metabolic process GO:0030168 platelet activation GO:0030335 positive regulation of cell migration GO:0031647 regulation of protein stability GO:0031663 lipopolysaccharide-mediated signaling pathway GO:0032496 response to lipopolysaccharide GO:0032872 regulation of stress-activated MAPK cascade GO:0033598 mammary gland epithelial cell proliferation GO:0034134 toll-like receptor 2 signaling pathway GO:0034138 toll-like receptor 3 signaling pathway GO:0034142 toll-like receptor 4 signaling pathway GO:0034146 toll-like receptor 5 signaling pathway GO:0034162 toll-like receptor 9 signaling pathway GO:0034166 toll-like receptor 10 signaling pathway GO:0035556 intracellular signal transduction GO:0035666 TRIF-dependent toll-like receptor signaling pathway GO:0038095 Fc-epsilon receptor signaling pathway GO:0038096 Fc-gamma receptor signaling pathway involved in phagocytosis GO:0038123 toll-like receptor TLR1:TLR2 signaling pathway GO:0038127 ERBB signaling pathway GO:0043330 response to exogenous dsRNA GO:0043627 response to estrogen GO:0045087 innate immune response GO:0045596 negative regulation of cell differentiation GO:0045727 positive regulation of translation GO:0045893 positive regulation of transcription, DNA-templated GO:0048011 neurotrophin TRK receptor signaling pathway GO:0050852 T cell receptor signaling pathway GO:0050853 B cell receptor signaling pathway GO:0051090 regulation of sequence-specific DNA binding transcription factor activity GO:0051403 stress-activated MAPK cascade GO:0051493 regulation of cytoskeleton organization GO:0060397 JAK-STAT cascade involved in growth hormone signaling pathway GO:0060716 labyrinthine layer blood vessel development GO:0070371 ERK1 and ERK2 cascade GO:0070849 response to epidermal growth factor GO:0072584 caveolin-mediated endocytosis GO:0090170 regulation of Golgi inheritance GO:2000641 regulation of early endosome to late endosome transport GO:0000166 nucleotide binding GO:0001784 phosphotyrosine binding GO:0003677 DNA binding GO:0004672 protein kinase activity GO:0004674 protein serine/threonine kinase activity GO:0004707 MAP kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0008134 transcription factor binding GO:0008353 RNA polymerase II carboxy-terminal domain kinase activity GO:0016301 kinase activity GO:0016740 transferase activity GO:0016772 transferase activity, transferring phosphorus-containing groups GO:0019902 phosphatase binding GO:0031435 mitogen-activated protein kinase kinase kinase binding GO:0005634 nucleus GO:0005654 nucleoplasm GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005769 early endosome GO:0005770 late endosome GO:0005794 Golgi apparatus GO:0005815 microtubule organizing center GO:0005819 spindle GO:0005829 cytosol GO:0005856 cytoskeleton GO:0005901 caveola GO:0005925 focal adhesion GO:0015630 microtubule cytoskeleton GO:0031143 pseudopodium GO:0032839 dendrite cytoplasm GO:0043204 perikaryon GO:0043234 protein complex GO:0072686 mitotic spindle GO:0005730 nucleolus GO:0003677 DNA binding GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedHomo sapiens
Sequence length360
FASTA sequence>sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Structure Information
PDB ID2Y9Q, 4FMQ, 4FV6, 1WZY, 3W55, 1TVO, 2OJG, 2OJI, 2OJJ, 3I5Z, 3I60, 4FV1, 4FV2, 4FV3, 4FV4, 4FV5, 4FV8, 4FV9, 4G6N, 3TEI, 4H3P, 4FV7, 4G6O, 3O71, 3C9W, 2Z7L, 2FYS, 1ERK, 3ERK, 4ERK, 3QYI, 4H3Q
Quaternary structure
Function 1
Function descriptionErk2 kinase, enzyme Serine/threonine kinase ATP + a protein => ADP + a phosphoprotein.
References for functionK├╝ltz, Dietmar. "Phylogenetic and functional classification of mitogen-and stress-activated protein kinases." Journal of molecular evolution 46.5 (1998): 571-588.
E.C. number2.7.11.24
Location of functional site(s)Active site:149 Binding site:108,154,166,54,167,114 DNA binding site:259-277 Nucleotide binding site:31-39
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscriptional repressor represses expression of interferon gamma-induced genes
References for functionHu S1, Xie Z, Onishi A, Yu X, Jiang L, Lin J, Rho HS, Woodard C, Wang H, Jeong JS, Long S, He X, Wade H, Blackshaw S, Qian J, Zhu H.Profiling the human protein-DNA interactome reveals ERK2 as a transcriptional repressor of interferon signaling.Cell. 2009 Oct 30;139(3):610-22. doi: 10.1016/j.cell.2009.08.037. PMID: 19879846
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments