Protein Information

General Information
MoonProt ID174
First appeared in release1.0
Name(s)50S ribosomal protein L7 50S ribosomal protein L7Ae Ribosomal protein L8e Gene Name: rpl7ae
UniProt IDP54066 (RL7A_METJA), Reviewed
GO termsGO:0006412 translation GO:0042254 ribosome biogenesis GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0005515 protein binding GO:0005622 intracellular GO:0005840 ribosome GO:0030529 ribonucleoprotein complex GO:0030515 snoRNA binding
Organisms for which functions have been demonstratedMethanococcus jannaschii
Sequence length117
FASTA sequence>gi|56965936|pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein GSHMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Structure Information
PDB ID1RA4, 1XBI, 1SDS, 3PAF
Quaternary structure
Function 1
Function descriptionpart of the ribosome
References for functionKravchenko, Olesya, et al. "Structure of a two-domain N-terminal fragment of ribosomal protein L10 from Methanococcus jannaschii reveals a specific piece of the archaeal ribosomal stalk." Journal of molecular biology 399.2 (2010): 214-220.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of ribosome
Comments
Function 2
Function descriptionsRNP core protein binds the box C/D snoRNA core motif, homologue of eukaryotic 15.5kD protein
References for functionKuhn JF, Tran EJ, Maxwell ES. Archaeal ribosomal protein L7 is a functional homolog of the eukaryotic 15.5kD/Snu13p snoRNP core protein. Nucleic Acids Res. 2002 Feb 15. PMID: 11842104
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments