Protein Information

General Information
MoonProt ID175
First appeared in release1.0
Name(s)RACK1 Guanine nucleotide-binding protein subunit beta-like protein Receptor for activated C kinase Receptor of activated protein kinase C 1 Gene Name: ASC1
UniProt IDP38011 (GBLP_YEAST), Reviewed
GO termsGO:0001403 invasive growth in response to glucose limitation GO:0007186 G-protein coupled receptor signaling pathway GO:0010255 glucose mediated signaling pathway GO:0017148 negative regulation of translation GO:0050790 regulation of catalytic activity GO:0001965 G-protein alpha-subunit binding GO:0004871 signal transducer activity GO:0005092 GDP-dissociation inhibitor activity GO:0005737 cytoplasm GO:0022627 cytosolic small ribosomal subunit GO:0032947 protein complex scaffold activity
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length319
FASTA sequence>sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Structure Information
PDB ID3IZB, 3O2Z, 3O30, 3U5C, 3U5G, 4BYL, 4BYT, 3RFG, 3RFH, 1TRJ, 3JYV, 3FRX,
Quaternary structure
Function 1
Function descriptionComponent of the 40S (small) ribosomal subunit
References for functionSengupta J, Nilsson J, Gursky R, Spahn CM, Nissen P, Frank J. Identification of the versatile scaffold protein RACK1 on the eukaryotic ribosome by cryo-EM. Nat Struct Mol Biol. 2004 Oct. PMID: 15334071
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptionscaffold in cytoplasmic signal transduction pathways
References for functionKadrmas JL, Smith MA, Pronovost SM, Beckerle MC. Characterization of RACK1 function in Drosophila development. Dev Dyn. 2007 Aug. PMID: 17584887
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments