Protein Information

General Information
MoonProt ID178
First appeared in release1.0
Name(s)60S ribosomal protein L30 L32 RP73 YL38 RPL32 Gene Name: RPL30
UniProt IDP14120 (RL30_YEAST), Reviewed
GO termsGO:0002181 cytoplasmic translation GO:0006364 rRNA processing GO:0006412 translation GO:0017148 negative regulation of translation GO:0048025 negative regulation of mRNA splicing, via spliceosome GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0030627 pre-mRNA 5'-splice site binding GO:0005622 intracellular GO:0005737 cytoplasm GO:0005840 ribosome GO:0022625 cytosolic large ribosomal subunit GO:0030529 ribonucleoprotein complex GO:0043484 regulation of RNA splicing
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length105
FASTA sequence>sp|P14120|RL30_YEAST 60S ribosomal protein L30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL30 PE=1 SV=3 MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Structure Information
PDB ID1T0K, 3IZS, 3O58, 3O5H, 3U5E, 3U5I, 4B6A, 1CK2, 1CN7, 1NMU, 4BYN, 4BYU, 3JYW
Quaternary structure
Function 1
Function descriptionComponent of the ribosome large subunit (60S)
References for functionDabeva, Mariana D., and Jonathan R. Warner. "Ribosomal protein L32 of Saccharomyces cerevisiae regulates both splicing and translation of its own transcript." Journal of Biological Chemistry268.26 (1993): 19669-19674.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of the ribosome
Comments
Function 2
Function descriptioninhibits the splicing of the transcript of its own gene, RPL32
References for functionEng FJ, Warner JR. Structural basis for the regulation of splicing of a yeast messenger RNA. Cell. 1991 May 31. PMID: 2040015
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments