Protein Information

General Information
MoonProt ID180
First appeared in release1.0
Name(s)60S ribosomal protein L2-A L5 RP8 YL6 Gene Name:RPL2A
UniProt IDP0CX45 (RL2A_YEAST) Reviewed
GO termsGO:0002181 cytoplasmic translation GO:0006412 translation GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0019843 rRNA binding GO:0005622 intracellular GO:0005737 cytoplasm GO:0005840 ribosome GO:0022625 cytosolic large ribosomal subunit GO:0030529 ribonucleoprotein complex GO:0003723 RNA binding GO:0003729 mRNA binding
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length254
FASTA sequence>sp|P0CX45|RL2A_YEAST 60S ribosomal protein L2-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2A PE=1 SV=1 MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD
Structure Information
PDB ID3IZS, 3O58, 3O5H, 3U5E, 3U5I, 4B6A, 1S1I, 4BYN, 4BYU, 3JYW,
Quaternary structure
Function 1
Function descriptionComponent of the ribosome large subunit (60S).
References for functionLucioli, A. L. E. S. S. A. N. D. R. A., et al. "Gene dosage alteration of L2 ribosomal protein genes in Saccharomyces cerevisiae: effects on ribosome synthesis." Molecular and cellular biology 8.11 (1988): 4792-4798.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionregulates accumulation of L2 mRNA, shortens half-life of L2 mRNA
References for functionPresutti C, Ciafr? SA, Bozzoni I. The ribosomal protein L2 in S. cerevisiae controls the level of accumulation of its own mRNA. EMBO J. 1991 Aug. PMID: 2065661
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments