Protein Information

General Information
MoonProt ID182
First appeared in release1.0
Name(s)60S ribosomal protein L12 Gene Name:rpl-12
UniProt IDP61866 (RL12_CAEEL), Reviewed
GO termsGO:0006412 translation GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0005840 ribosome GO:0030529 ribonucleoprotein complex GO:0003723 RNA binding GO:0043484 regulation of RNA splicing
Organisms for which functions have been demonstratedCaenorhabditis elegans
Sequence length165
FASTA sequence>sp|P61866|RL12_CAEEL 60S ribosomal protein L12 OS=Caenorhabditis elegans GN=rpl-12 PE=3 SV=1 MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKATQDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVKHNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQHPHDIIESIANGEIEIPAQ
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionribosomal protein Binds RNA directly (26S rRNA)
References for functionSonnichsen, B., et al. "Full-genome RNAi profiling of early embryogenesis in Caenorhabditis elegans." Nature 434.7032 (2005): 462.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of ribosome
Comments
Function 2
Function descriptioninhibits splicing of its own RNA
References for functionMitrovich QM, Anderson P. Unproductively spliced ribosomal protein mRNAs are natural targets of mRNA surveillance in C. elegans. Genes Dev. 2000 Sep 1. PMID: 10970881
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments