Protein Information

General Information
MoonProt ID191
First appeared in release1.0
Name(s)60S ribosomal protein L10-1 Gene Name:RPL10A
UniProt IDQ93VT9 (RL101_ARATH), Reviewed
GO termsGO:0001510 RNA methylation GO:0006412 translation GO:0006952 defense response GO:0032502 developmental process GO:0071493 cellular response to UV-B GO:0003735 structural constituent of ribosome GO:0005515 protein binding GO:0005622 intracellular GO:0005634 nucleus GO:0005730 nucleolus GO:0005737 cytoplasm GO:0005773 vacuole GO:0005774 vacuolar membrane GO:0005829 cytosol GO:0005840 ribosome GO:0009507 chloroplast GO:0022625 cytosolic large ribosomal subunit GO:0022626 cytosolic ribosome GO:0030529 ribonucleoprotein complex GO:0005794 Golgi apparatus GO:0005515 protein binding
Organisms for which functions have been demonstratedArabidopsis thaliana
Sequence length220
FASTA sequence>sp|Q93VT9|RL101_ARATH 60S ribosomal protein L10-1 OS=Arabidopsis thaliana GN=RPL10A PE=1 SV=1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGVNAKFLSCHGPLANRQPGSAFLPAHY
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionribosomal protein, part of 40S subunit
References for functionYamada, Kayoko, et al. "Empirical analysis of transcriptional activity in the Arabidopsis genome." Science 302.5646 (2003): 842-846.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of ribosome
Comments
Function 2
Function descriptionInvolved in NSP-interacting kinase (NIK) receptor-mediated defense pathway to defend against geminivirus substrate and binding partner of NIK1
References for functionCarvalho CM, Santos AA, Pires SR, Rocha CS, Saraiva DI, Machado JP, Mattos EC, Fietto LG, Fontes EP. Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus. PLoS Pathog. 2008 Dec. PMID: 19112492
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleos
Comments