Protein Information

General Information
MoonProt ID192
First appeared in release1.0
Name(s)40S ribosomal protein S3 Gene Name:RpS3
UniProt IDQ06559 (RS3_DROME), Reviewed
GO termsGO:0000737 DNA catabolic process, endonucleolytic GO:0002181 cytoplasmic translation GO:0006281 DNA repair GO:0006412 translation GO:0006974 cellular response to DNA damage stimulus GO:0007067 mitosis GO:0032088 negative regulation of NF-kappaB transcription factor activity GO:0043524 negative regulation of neuron apoptotic process GO:0090305 nucleic acid phosphodiester bond hydrolysis GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0003906 DNA-(apurinic or apyrimidinic site) lyase activity GO:0004518 nuclease activity GO:0004519 endonuclease activity GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity GO:0016787 hydrolase activity GO:0005622 intracellular GO:0005634 nucleus GO:0005737 cytoplasm GO:0005840 ribosome GO:0005875 microtubule associated complex GO:0015935 small ribosomal subunit GO:0016363 nuclear matrix GO:0030529 ribonucleoprotein complex GO:0006281 DNA repair GO:0052720 apurinic/apyrimidinic endodeoxyribonuclease activity
Organisms for which functions have been demonstratedDrosophila melanogaster
Sequence length246
FASTA sequence>sp|Q06559|RS3_DROME 40S ribosomal protein S3 OS=Drosophila melanogaster GN=RpS3 PE=1 SV=1 MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
Structure Information
PDB ID3J38
Quaternary structure
Function 1
Function descriptionribosomal protein, part of 40S subunit
References for functionKelley, Mark R., et al. "The Drosophila S3 multifunctional DNA repair/ribosomal protein protects Fanconi anemia cells against oxidative DNA damaging agents." Mutation Research/DNA Repair485.2 (2001): 107-119.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, part of ribosome
Comments
Function 2
Function descriptionDNA repair activity cleaves DNA at apurinic/apyrimidinic sites
References for functionWilson DM, Deutsch WA, Kelley MR. Drosophila ribosomal protein S3 contains an activity that cleaves DNA at apurinic/apyrimidinic sites. J Biol Chem. 1994 Oct 14. PMID: 7929231
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Comments