Protein Information

General Information
MoonProt ID200
First appeared in release1.0
Name(s)MalY Cystathionine beta-lyase MalY Beta-cystathionase Cysteine lyase CBL Gene Name:malY
UniProt IDP23256 (MALY_ECOLI), Reviewed
GO termsGO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0008652 cellular amino acid biosynthetic process GO:0009058 biosynthetic process GO:0009086 methionine biosynthetic process GO:0043433 negative regulation of sequence-specific DNA binding transcription factor activity GO:0003824 catalytic activity GO:0004121 cystathionine beta-lyase activity GO:0005515 protein binding GO:0016829 lyase activity GO:0030170 pyridoxal phosphate binding GO:0080146 L-cysteine desulfhydrase activity GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length390
FASTA sequence>sp|P23256|MALY_ECOLI Protein MalY OS=Escherichia coli (strain K12) GN=malY PE=1 SV=1 MFDFSKVVDRHGTWCTQWDYVADRFGTADLLPFTISDMDFATAPCIIEALNQRLMHGVFGYSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAIRAVR
Structure Information
PDB ID1D2F
Quaternary structure
Function 1
Function descriptionbeta-cystathionase, enzyme cleavage of cystathionine to homocysteine, ammonia, and pyruvate L-cystathionine + H2O => L-homocysteine + NH3 + pyruvate Amino-acid biosynthesis, methionine biosynthesis
References for functionZdych E, Peist R, Reidl J, Boos W. MalY of Escherichia coli is an enzyme with the activity of a beta C-S lyase (cystathionase). J Bacteriol. 1995 Sep. PMID: 7665481
E.C. number4.4.1.8
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscription regulation binds to MalT activator of mal regulon and prevents its action
References for functionJoly N, Danot O, Schlegel A, Boos W, Richet E. The Aes protein directly controls the activity of MalT, the central transcriptional activator of the Escherichia coli maltose regulon. J Biol Chem. 2002 May 10. PMID: 11867639 Zdych E, Peist R, Reidl J, Boos W. MalY of Escherichia coli is an enzyme with the activity of a beta C-S lyase (cystathionase). J Bacteriol. 1995 Sep. PMID: 7665481
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments