Protein Information

General Information
MoonProt ID204
First appeared in release1.0
Name(s)Uridylate kinase UMP kinase UMPK Uridine monophosphate kinase Gene Name:pyrH
UniProt IDP0A7E9 (PYRH_ECOLI), Reviewed
GO termsGO:0006221 pyrimidine nucleotide biosynthetic process GO:0008152 metabolic process GO:0016310 phosphorylation GO:0044210 'de novo' CTP biosynthetic process GO:0046939 nucleotide phosphorylation GO:0000166 nucleotide binding GO:0003824 catalytic activity GO:0005524 ATP binding GO:0009041 uridylate kinase activity GO:0016301 kinase activity GO:0016740 transferase activity GO:0033862 UMP kinase activity GO:0042802 identical protein binding GO:0005737 cytoplasm GO:0005829 cytosol GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length241
FASTA sequence>sp|P0A7E9|PYRH_ECOLI Uridylate kinase OS=Escherichia coli (strain K12) GN=pyrH PE=1 SV=2 MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Structure Information
PDB ID2BNE 2V4Y 2BND 2BNF
Quaternary structure
Function 1
Function descriptionUMP kinase, enzyme phosphorylates UMP to UDP ATP + UMP <=> ADP + UDP de novo biosynthetic pathway of pyrimidine nucleotides
References for functionBucurenci N, Serina L, Zaharia C, Landais S, Danchin A, B?rzu O. Mutational analysis of UMP kinase from Escherichia coli. J Bacteriol. 1998 Feb. PMID: 9457846
E.C. number2.7.4.22
Location of functional site(s)binding site: 57, 58, 62, 77, 165, 171, 174; nucleotide binding: 15-18, 138-145
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscriptional regulator involved in pyrimidine-specific repression of the carAB operon binds to PepA
References for functionKholti A, Charlier D, Gigot D, Huysveld N, Roovers M, Glansdorff N. pyrH-encoded UMP-kinase directly participates in pyrimidine-specific modulation of promoter activity in Escherichia coli. J Mol Biol. 1998 Jul 24. PMID: 9677289
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments