Protein Information

General Information
MoonProt ID205
First appeared in release1.0
Name(s)Cysteine synthase A CSase O-acetylserine (thiol)-lyase OAS-TL Superoxide-inducible protein 11 SOI11 Gene Name:cysK
UniProt IDP37887 (CYSK_BACSU), Reviewed
GO termsGO:0006535 cysteine biosynthetic process from serine GO:0008652 cellular amino acid biosynthetic process GO:0019344 cysteine biosynthetic process GO:0004124 cysteine synthase activity GO:0016740 transferase activity GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedBacillus subtilis
Sequence length308
FASTA sequence>sp|P37887|CYSK_BACSU Cysteine synthase OS=Bacillus subtilis (strain 168) GN=cysK PE=1 SV=3 MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYLSTPLYQFD
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionCysteine synthase, enzyme O-acetyl-serine + H2S = cysteine + acetate Amino-acid biosynthesis, biosynthesis of cysteine
References for functionHullo MF1, Auger S, Soutourina O, Barzu O, Yvon M, Danchin A, Martin-Verstraete I. Conversion of methionine to cysteine in Bacillus subtilis and its regulation.J Bacteriol. 2007 Jan;189(1):187-97. PMID: 17056751
E.C. number2.5.1.47
Location of functional site(s)binding site: 75, 267
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscriptional regulator regulates activity of CymR transcription factor forms complex with CymR that represses transcription of the CymR regulon
References for functionTanous C, Soutourina O, Raynal B, Hullo MF, Mervelet P, Gilles AM, Noirot P, Danchin A, England P, MartinVerstraete I. The CymR regulator in complex with the enzyme CysK controls cysteine metabolism in Bacillus subtilis. J Biol Chem. 2008 Dec 19. PMID: 18974048 Hullo MF, Auger S, Soutourina O, Barzu O, Yvon M, Danchin A, MartinVerstraete I. Conversion of methionine to cysteine in Bacillus subtilis and its regulation. J Bacteriol. 2007 Jan. PMID: 17056751
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments