Protein Information

General Information
MoonProt ID206
First appeared in release1.0
Name(s)Acetyl esterase EcE Gene Name:aes
UniProt IDP23872 (AES_ECOLI), Reviewed
GO termsGO:0008152 metabolic process GO:0043433 negative regulation of sequence-specific DNA binding transcription factor activity GO:0051346 negative regulation of hydrolase activity GO:0005515 protein binding GO:0008126 acetylesterase activity GO:0016787 hydrolase activity GO:0034338 short-chain carboxylesterase activity GO:0052689 carboxylic ester hydrolase activity GO:0005737 cytoplasm GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length319
FASTA sequence>sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain K12) GN=aes PE=1 SV=3 MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Structure Information
PDB ID4KRX 4KRY
Quaternary structure
Function 1
Function descriptionesterase, enzyme esterase of short chain fatty esters with up to 8 carbons in acyl chain
References for functionPeist R, Koch A, Bolek P, Sewitz S, Kolbus T, Boos W. Characterization of the aes gene of Escherichia coli encoding an enzyme with esterase activity. J Bacteriol. 1997 Dec. PMID: 9401025. Haruki M, Oohashi Y, Mizuguchi S, Matsuo Y, Morikawa M, Kanaya S. Identification of catalytically essential residues in Escherichia coli esterase by site-directed mutagenesis. FEBS Lett. 1999 Jul 9. PMID: 10431819. Kanaya S, Koyanagi T, Kanaya E. An esterase from Escherichia coli with a sequence similarity to hormone-sensitive lipase. Biochem J. 1998 May 15. PMID: 9576853.
E.C. number3.1.1.-
Location of functional site(s)active site: 165, 262, 292
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranscription regulation binds to MalT activator of mal regulon and prevents its action
References for functionJoly N, Danot O, Schlegel A, Boos W, Richet E. The Aes protein directly controls the activity of MalT, the central transcriptional activator of the Escherichia coli maltose regulon. J Biol Chem. 2002 May 10. PMID: 11867639
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments