Protein Information

General Information
MoonProt ID208
First appeared in release1.0
Name(s)Trifunctional NAD biosynthesis/regulator protein NadR Transcriptional regulator NadR Nicotinamide mononucleotide adenylyltransferase NMN adenylyltransferase NMN-AT NMNAT Nicotinamide ribonucleotide adenylyltransferase Nicotinamide-nucleotide adenylyltransferase Ribosylnicotinamide kinase RNK Nicotinamide riboside kinase NRK NmR-K Gene Name:nadR ***This protein has two different enzyme functions. We consider it to be a Moonlighting Protein because it has a transcription repressor function in addition to the enzyme functions.****
UniProt IDP27278 (NADR_ECOLI), Reviewed
GO termsGO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0006810 transport GO:0008152 metabolic process GO:0009058 biosynthetic process GO:0009435 NAD biosynthetic process GO:0016310 phosphorylation GO:0019363 pyridine nucleotide biosynthetic process GO:0045892 negative regulation of transcription, DNA-templated GO:0000166 nucleotide binding GO:0000287 magnesium ion binding GO:0000309 nicotinamide-nucleotide adenylyltransferase activity GO:0000986 bacterial-type RNA polymerase core promoter proximal region sequence-specific DNA binding GO:0003677 DNA binding GO:0003824 catalytic activity GO:0005524 ATP binding GO:0016301 kinase activity GO:0016740 transferase activity GO:0043565 sequence-specific DNA binding GO:0050262 ribosylnicotinamide kinase activity GO:0005737 cytoplasm GO:0005886 plasma membrane GO:0016020 membrane GO:0003677 DNA binding GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedEscherichia coli
Sequence length410
FASTA sequence>sp|P27278|NADR_ECOLI Trifunctional NAD biosynthesis/regulator protein NadR OS=Escherichia coli (strain K12) GN=nadR PE=1 SV=2 MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTVPDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEEADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionnicotinamide mononucleotide (NMN) adenylyltransferase and ribosylnicotinamide (RN) kinase activities, enzyme ATP + nicotinamide ribonucleotide => diphosphate + NAD+ ATP + 1-(beta-D-ribofuranosyl)-nicotinamide => ADP + beta-nicotinamide D-ribonucleotide NAD biosynthesis
References for functionRaffaelli, Nadia, et al. "The Escherichia coli NadR regulator is endowed with nicotinamide mononucleotide adenylyltransferase activity." Journal of bacteriology 181.17 (1999): 5509-5511.
E.C. number2.7.7.1 and 2.7.1.22
Location of functional site(s)binding site: 77, 104; DNA binding: 18-37; nucleotide binding: 70-73, 144-157, 177-179, 204-206, 259-261, 294-297
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionTranscriptional repressor binds to the nadB operator DNA sequence Increasing NAD causes an increase in the affinity of NadR for the nadB operator regions of nadA, nadB, and pncB
References for functionRaffaelli N, Lorenzi T, Mariani PL, Emanuelli M, Amici A, Ruggieri S, Magni G. The Escherichia coli NadR regulator is endowed with nicotinamide mononucleotide adenylyltransferase activity. J Bacteriol. 1999 Sep. PMID: 10464228
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm, binds to DNA
Comments