Protein Information

General Information
MoonProt ID211
First appeared in release1.0
Name(s)Maltose/maltodextrin import ATP-binding protein MalK Gene Name:malK
UniProt IDP68187 (MALK_ECOLI), Reviewed
GO termsGO:0006200 ATP catabolic process GO:0006810 transport GO:0008152 metabolic process GO:0008643 carbohydrate transport GO:0015768 maltose transport GO:0042956 maltodextrin transport GO:0055085 transmembrane transport GO:0000166 nucleotide binding GO:0005215 transporter activity GO:0005524 ATP binding GO:0015423 maltose-transporting ATPase activity GO:0015609 maltooligosaccharide-importing ATPase activity GO:0016787 hydrolase activity GO:0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances GO:0016887 ATPase activity GO:0017111 nucleoside-triphosphatase activity GO:0005886 plasma membrane GO:0016020 membrane GO:0043190 ATP-binding cassette (ABC) transporter complex GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length371
FASTA sequence>sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Structure Information
PDB ID1Q12 1Q1E 2AWN 2AWO 3FH6 3PUY 3PUZ 3PV0 3PUV 3PUW 3PUX 3RLF 4JBW 4KHZ 4KI0 1Q1B 2R6G
Quaternary structure
Function 1
Function descriptionATP binding/hydrolysis protein of MalEFGK maltose/maltodextrin transporter (importer) an ABC transporter ATP + H2O = ADP + phosphate
References for functionDavidson AL, Nikaido H. Purification and characterization of the membrane-associated components of the maltose transport system from Escherichia coli. J Biol Chem. 1991 May 15. PMID: 2026607. K?hnau S, Reyes M, Sievertsen A, Shuman HA, Boos W. The activities of the Escherichia coli MalK protein in maltose transport, regulation, and inducer exclusion can be separated by mutations. J Bacteriol. 1991 Apr. PMID: 2007546.
E.C. number3.6.3.19
Location of functional site(s)nucleotide binding: 36-43
Cellular location of functioninner membrane, peripheral membrane protein
Comments
Function 2
Function descriptiontranscription regulation binds to MalT activator of mal regulon and prevents its action
References for functionPanagiotidis CH, Boos W, Shuman HA. The ATP-binding cassette subunit of the maltose transporter MalK antagonizes MalT, the activator of the Escherichia coli mal regulon. Mol Microbiol. 1998 Nov. PMID: 9822819. K?hnau S, Reyes M, Sievertsen A, Shuman HA, Boos W. The activities of the Escherichia coli MalK protein in maltose transport, regulation, and inducer exclusion can be separated by mutations. J Bacteriol. 1991 Apr. PMID: 2007546.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioninner membrane, peripheral membrane protein
Comments