Protein Information

General Information
MoonProt ID213
First appeared in release1.0
Name(s)dihydroxyacetone kinase PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL Gene Name:dhaL
UniProt IDP76014 (DHAL_ECOLI), Reviewed
GO termsGO:0006071 glycerol metabolic process GO:0016310 phosphorylation GO:0019563 glycerol catabolic process GO:0000166 nucleotide binding GO:0000287 magnesium ion binding GO:0004371 glycerone kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0016301 kinase activity GO:0016740 transferase activity GO:0016772 transferase activity, transferring phosphorus-containing groups GO:0043531 ADP binding contributes_to GO:0016740 transferase activity GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length210
FASTA sequence>sp|P76014|DHAL_ECOLI PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL OS=Escherichia coli (strain K12) GN=dhaL PE=1 SV=3 MSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Structure Information
PDB ID2BTD 3PNL 4LRZ
Quaternary structure
Function 1
Function descriptionsubunit of dihydroxyacetone kinase, enzyme phosphorylates dihydroxyacetone contains the ADP-binding site
References for functionOberholzer, Anselm Erich, et al. "Crystal structure of the nucleotide-binding subunit DhaL of the Escherichia coli dihydroxyacetone kinase." Journal of molecular biology 359.3 (2006): 539-545.
E.C. number2.7.-.-
Location of functional site(s)metal binding: 30, 35, 37; binding site: 121, 130, 178; neocleotide binding: 38-41, 79-80, 191-193
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptioncoactivator of DhaR transcription activator binds to DhaR affects transcription of the dhaKLM operon
References for functionB?chler C, Schneider P, B?hler P, Lustig A, Erni B. Escherichia coli dihydroxyacetone kinase controls gene expression by binding to transcription factor DhaR. EMBO J. 2005 Jan 26. PMID: 15616579
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments