Protein Information

General Information
MoonProt ID215
First appeared in release1.0
Name(s)Formiminotransferase glutamate formiminotransferase FT
UniProt IDQ9HI69 (Q9HI69_THEAC), Unreviewed
GO termsGO:0008152 metabolic process GO:0005542 folic acid binding GO:0016740 transferase activity GO:0030272 5-formyltetrahydrofolate cyclo-ligase activity
Organisms for which functions have been demonstratedThermoplasma acidophilum
Sequence length303
FASTA sequence>tr|Q9HI69|Q9HI69_THEAC Probable glutamate formiminotransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1476 PE=4 SV=1 MSLVECVPNFSEGRDRDRVNRIRDAIASVDTVKILDVEMDPNHNRSVITFVCDSSKAVDAAFAGIKAAAEIIDMDAHRGEHPRFGAADVIPFVPLQDTKMETCVRLARDLGKRVGEELGIPVYLYAEAAQRPDRSDLAAIRNKNFQYEQLKEAIKEEKWKPDFGPSVVGKAGASIIGARDFLIAYNVNLNTSNMEIGKKIASAIRAKDGGLTFVKSLAFFLKDKNMVQISMNLTNYRKTPIYRAYELVRLEAARYGVLPVESEIVGLVPEQALIDVAKYYLQLNGFDEGNILERKMEKAANME
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionformiminotransferase, enzyme histidine breakdown
References for functionJeanguenin L, LaraN??ez A, Pribat A, Mageroy MH, Gregory JF, Rice KC, de Cr?cyLagard, Hanson AD. Moonlighting glutamate formiminotransferases can functionally replace 5-formyltetrahydrofolate cycloligase. J Biol Chem. 2010 Dec 31. PMID: 20952389
E.C. number
Location of functional site(s)active site: 81
Cellular location of functioncytoplasm
Comments
Function 2
Function description5-formyltetrahydrofolate cycloligase ATP + 5-formyltetrahydrofolate <=> ADP + phosphate + 5,10-methenyltetrahydrofolate
References for functionJeanguenin L, LaraN??ez A, Pribat A, Mageroy MH, Gregory JF, Rice KC, de Cr?cyLagard, Hanson AD. Moonlighting glutamate formiminotransferases can functionally replace 5-formyltetrahydrofolate cycloligase. J Biol Chem. 2010 Dec 31. PMID: 20952389
E.C. number 6.3.3.2
Location of functional site(s)
Cellular location of functioncytoplasm
Comments