Protein Information

General Information
MoonProt ID217
First appeared in release1.0
Name(s)Sarcosine oxidase, beta subunit SOX L-proline dehydrogenase
UniProt IDQ5JFG7 (Q5JFG7_THEKO), Unreviewed
GO termsGO:0055114 oxidation-reduction process GO:0016491 oxidoreductase activity GO:0004657 proline dehydrogenase activity
Organisms for which functions have been demonstratedThermococcus kodakarensis
Sequence length386
FASTA sequence>tr|Q5JFG7|Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0117 PE=4 SV=1 MPTRELPEKSEITIIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFNDEANVQVMKRSVELWKKYSEEYGFPFQQTGYLFLLYDDEEVETFKRNIAIQNKFGVPTRLITPEEAKEIVPLLDISEVVAASWNPTDGKASPFHSTAKFALHAEEFGAKLVEYTEVKDFIIENGEIKGLKTSRGTIKTGIVVNATNAWAKLINAMAGIRTKIPIEPYKHQAVITQPIKKGSVKPMVISFRYGHAYLTQTSHGGIIGGVGYEEGPTYDLNPTYEFLREVSYYFTKIIPALRELLILRTWAGYYAKTPDSNPAIGKIEELSDYYIAAGFSGHGFMMAPAVAEMVADLITKGKTDLPAWWYDPYRFERGELRGKALQMG
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionSarcosine oxidase, enzyme oxidation of the methyl group in sarcosine and transfer to folate oxidative demethylation of sarcosine to yield glycine and 5,10-CH2-tetrahydrofolate
References for functionLee S, Jia B, Pham BP, Shao Y, Kwak JM, Cheong GW. Architecture and characterization of sarcosine oxidase from Thermococcus kodakarensis KOD1. Extremophiles. 2012 Jan. PMID: 22083128
E.C. number1.5.3.1
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionL-proline dehydrogenase, enzyme L-proline + acceptor <=> (S)-1-pyrroline-5-carboxylate + reduced acceptor
References for functionLee S, Jia B, Pham BP, Shao Y, Kwak JM, Cheong GW. Architecture and characterization of sarcosine oxidase from Thermococcus kodakarensis KOD1. Extremophiles. 2012 Jan. PMID: 22083128
E.C. number1.5.99.8
Location of functional site(s)
Cellular location of functioncytoplasm
Comments