Protein Information

General Information
MoonProt ID219
First appeared in release1.0
Name(s)Thymidylate synthase 5,10-methylenetetrahydrofolate:dUMP C-methyltransferase TS TSase Gene Name:TYMS
UniProt IDP04818 (TYSY_HUMAN) Reviewed
GO termsGO:0000082 G1/S transition of mitotic cell cycle GO:0000083 regulation of transcription involved in G1/S transition of mitotic cell cycle GO:0000278 mitotic cell cycle GO:0005976 polysaccharide metabolic process GO:0006139 nucleobase-containing compound metabolic process GO:0006206 pyrimidine nucleobase metabolic process GO:0006231 dTMP biosynthetic process GO:0006235 dTTP biosynthetic process GO:0006260 DNA replication GO:0006281 DNA repair GO:0007568 aging GO:0007623 circadian rhythm GO:0009157 deoxyribonucleoside monophosphate biosynthetic process GO:0009165 nucleotide biosynthetic process GO:0009636 response to toxic substance GO:0014070 response to organic cyclic compound GO:0019088 immortalization of host cell by virus GO:0019860 uracil metabolic process GO:0031100 organ regeneration GO:0032259 methylation GO:0032570 response to progesterone GO:0033189 response to vitamin A GO:0034097 response to cytokine GO:0042493 response to drug GO:0044281 small molecule metabolic process GO:0045471 response to ethanol GO:0046078 dUMP metabolic process GO:0046134 pyrimidine nucleoside biosynthetic process GO:0046653 tetrahydrofolate metabolic process GO:0046683 response to organophosphorus GO:0048015 phosphatidylinositol-mediated signaling GO:0048589 developmental growth GO:0051216 cartilage development GO:0051384 response to glucocorticoid GO:0051593 response to folic acid GO:0055086 nucleobase-containing small molecule metabolic process GO:0060574 intestinal epithelial cell maturation GO:0000166 nucleotide binding GO:0003729 mRNA binding GO:0004799 thymidylate synthase activity GO:0005542 folic acid binding GO:0008144 drug binding GO:0008168 methyltransferase activity GO:0016740 transferase activity GO:0042803 protein homodimerization activity GO:0048037 cofactor binding GO:0005634 nucleus GO:0005654 nucleoplasm GO:0005730 nucleolus GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005743 mitochondrial inner membrane GO:0005759 mitochondrial matrix GO:0005829 cytosol GO:0016020 membrane GO:0006412 translation
Organisms for which functions have been demonstratedHomo sapiens
Sequence length313
FASTA sequence>sp|P04818|TYSY_HUMAN Thymidylate synthase OS=Homo sapiens GN=TYMS PE=1 SV=3 MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Structure Information
PDB ID2RD8, 2RDA, 3H9K, 3HB8, 3OB7, 4GYH, 4H1I, 3EF9, 3GH0, 1JU6, 1JUJ, 3EDW, 3EJL, 3GG5, 3GH24E28, 3N5E, 3EAW, 4G2O, 4G6W, 3EHI, 4FGT, 4GD7, 3N5E, 3EBU, 1HW4, 1HW3, 1YPV, 2ONB, 3N5G, 3EGY, 3ED7, 1HVY, 1HZW, 1I00
Quaternary structure
Function 1
Function descriptionthymidylate synthase, enzyme de novo synthesis of thymidylate, a DNA precursor 5,10-methylenetetrahydrofolate + dUMP <=> dihydrofolate + dTMP Pyrimidine metabolism, dTTP biosynthesis
References for functionCosti, M. P., et al. "Thymidylate synthase structure, function and implication in drug discovery." Current medicinal chemistry 12.19 (2005): 2241-2258.
E.C. number2.1.1.45
Location of functional site(s)binding site: 50, 218, 226, 312; active site: 195; nucleotide binding: 175-176, 215-218, 256-258
Cellular location of functioncytoplasm
CommentsMore complete list of PDB IDs: 2RD8, 2RDA, 3H9K, 3HB8, 3OB7, 4GYH, 4H1I, 3EF9, 3GH0, 1JU6, 1JUJ, 3EDW, 3EJL, 3GG5, 3GH2, 4E28, 3N5E, 3EAW, 4G2O, 4G6W, 3EHI, 4FGT, 4GD7, 3N5E, 3EBU, 1HW4, 1HW3, 1YPV, 2ONB, 3N5G, 3EGY, 3ED7, 1HVY, 1HZW, 1I00
Function 2
Function descriptionmRNA translation inhibition regulation of human TS mRNA translation does not bind to unrelated mRNAs
References for functionChu E, Koeller DM, Casey JL, Drake JC, Chabner BA, Elwood PC, Zinn S, Allegra CJ. Autoregulation of human thymidylate synthase messenger RNA translation by thymidylate synthase. Proc Natl Acad Sci U S A. 1991 Oct 15. PMID: 1924359
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments