Protein Information

General Information
MoonProt ID220
First appeared in release1.0
Name(s)Bifunctional dihydrofolate reductase-thymidylate synthase DHFR-TS
UniProt IDP13922 (DRTS_PLAFK), Reviewed
GO termsGO:0006231 dTMP biosynthetic process GO:0006545 glycine biosynthetic process GO:0006730 one-carbon metabolic process GO:0008152 metabolic process GO:0009165 nucleotide biosynthetic process GO:0032259 methylation GO:0046654 tetrahydrofolate biosynthetic process GO:0055114 oxidation-reduction process GO:0003824 catalytic activity GO:0006412 translation GO:0004146 dihydrofolate reductase activity GO:0004799 thymidylate synthase activity GO:0008168 methyltransferase activity GO:0016491 oxidoreductase activity GO:0016740 transferase activity
Organisms for which functions have been demonstratedPlasmodium falciparum
Sequence length608
FASTA sequence>sp|P13922|DRTS_PLAFK Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCNSLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
Structure Information
PDB ID3JSU, 3QG2, 4DP3, 4DPH, 3QGT, 3UM8, 4DPD, 3UM5, 3UM6, 1J3I, 1J3J, 1J3K, 3DG8, 3DGA
Quaternary structure
Function 1
Function descriptionDihydrofolate reductase and Thymidylate synthase, enzyme 5,6,7,8-tetrahydrofolate + NADP+ <=> 7,8-dihydrofolate + NADPH 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP Tetrahydrofolate biosynthesis
References for functionCowman, Alan F., et al. "Amino acid changes linked to pyrimethamine resistance in the dihydrofolate reductase-thymidylate synthase gene of Plasmodium falciparum." Proceedings of the National Academy of Sciences 85.23 (1988): 9109-9113.
E.C. number1.5.1.3 and EC=2.1.1.45
Location of functional site(s)binding site: 16, 31, 54, 108, 144, 164, 170, 185, 345,491, 521; active site: 490; nucleotide binding: 39-45, 106-108, 128-130, 165-172, 509-513, 551-553
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionmRNA translation inhibition regulation of plasmodium TS-DHFR mRNA translation
References for functionZhang K, Rathod PK. Divergent regulation of dihydrofolate reductase between malaria parasite and human host. Science. 2002 Apr 19. PMID: 11964483
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments