Protein Information

General Information
MoonProt ID224
First appeared in release1.0
Name(s)Bifunctional protein PyrR Pyrimidine operon regulatory protein Uracil phosphoribosyltransferase UPRTase Gene Name:pyrR
UniProt IDP41007 (PYRR_BACCL), Reviewed
GO termsGO:0006351 transcription, DNA-templated GO:0006353 DNA-templated transcription, termination GO:0006355 regulation of transcription, DNA-templated GO:0009116 nucleoside metabolic process GO:0003723 RNA binding GO:0004845 uracil phosphoribosyltransferase activity GO:0016740 transferase activity GO:0016757 transferase activity, transferring glycosyl groups GO:0003723 RNA binding GO:0003729 mRNA binding GO:0031555 transcriptional attenuation
Organisms for which functions have been demonstratedBacillus caldolyticus
Sequence length179
FASTA sequence>sp|P41007|PYRR_BACCL Bifunctional protein PyrR OS=Bacillus caldolyticus GN=pyrR PE=1 SV=1 MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRDDLTVKTDDHEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Structure Information
PDB ID1NON 1XZ8 1XZN 2IGB
Quaternary structure
Function 1
Function descriptionuracil phosphoribosyltransferase, enzyme UMP + diphosphate <=> uracil + 5-phospho-alpha-D-ribose 1-diphosphate
References for functionGhim SY, Neuhard J. The pyrimidine biosynthesis operon of the thermophile Bacillus caldolyticus includes genes for uracil phosphoribosyltransferase and uracil permease. J Bacteriol. 1994 Jun. PMID: 8206848
E.C. number2.4.2.9
Location of functional site(s)binding site: 137
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds mRNA transcriptional attenuation of the pyrimidine nucleotide biosynthetic (pyr) operon binds upstream of the genes being regulated
References for functionSwitzer RL, Turner RJ, Lu Y. Regulation of the Bacillus subtilis pyrimidine biosynthetic operon by transcriptional attenuation: control of gene expression by an mRNA-binding protein. Prog Nucleic Acid Res Mol Biol. 1999 0. PMID: 9932459
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments