Protein Information

General Information
MoonProt ID225
First appeared in release1.0
Name(s)Creatine kinase B-type B-CK Creatine kinase B chain Gene Name:Ckb
UniProt IDP07335 (KCRB_RAT), Reviewed
GO termsGO:0006603 phosphocreatine metabolic process GO:0007420 brain development GO:0016310 phosphorylation GO:0030644 cellular chloride ion homeostasis GO:0000166 nucleotide binding GO:0003824 catalytic activity GO:0004111 creatine kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0016301 kinase activity GO:0016740 transferase activity GO:0016772 transferase activity, transferring phosphorus-containing groups GO:0005737 cytoplasm GO:0005739 mitochondrion GO:0005886 plasma membrane GO:0003723 RNA binding GO:0006412 translation GO:0003730 mRNA 3-UTR binding GO:0003729 mRNA binding
Organisms for which functions have been demonstratedRattus norvegicus
Sequence length381
FASTA sequence>sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus GN=Ckb PE=1 SV=2 MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEDRHGGYQPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQPIDDLMPAQK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptioncreatine kinase, enzyme transfers phosphoryl group between ATP and various phosphogens (e.g. creatine phosphate) ATP + creatine <=> ADP + phosphocreatine
References for functionPayne, R. Mark, Robert C. Haas, and Arnold W. Strauss. "Structural characterization and tissue-specific expression of the mRNAs encoding isoenzymes from two rat mitochondrial creatine kinase genes." Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression 1089.3 (1991): 352-361.
E.C. number2.7.3.2
Location of functional site(s)binding site: 130, 132, 191, 232, 236, 285, 292, 320, 335; nucleotide binding: 128-132, 320-325
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds mRNA translation regulator binds 3' untranslated region (3' UTR) of mRNA of alpha myosin heavy chain (alphaMyHC)
References for functionVracarGrabar M, Russell B. Creatine kinase is an alpha myosin heavy chain 3'UTR mRNA binding protein. J Muscle Res Cell Motil. 2004 0. PMID: 15548869
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments