Protein Information

General Information
MoonProt ID242
First appeared in release1.0
Name(s)Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Multisynthase complex auxiliary component p38 Protein JTV-1 Gene Name: Aimp2
UniProt IDQ8R010 (AIMP2_MOUSE), Reviewed
GO termsGO:0006412 translation GO:0006915 apoptotic process GO:0007275 multicellular organismal development GO:0008285 negative regulation of cell proliferation GO:0030154 cell differentiation GO:0031398 positive regulation of protein ubiquitination GO:0060510 Type II pneumocyte differentiation GO:0005515 protein binding GO:0005634 nucleus GO:0005737 cytoplasm GO:0005829 cytosol GO:0005515 protein binding GO:0008134 transcription factor binding
Organisms for which functions have been demonstratedMus musculus
Sequence length320
FASTA sequence>sp|Q8R010|AIMP2_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Mus musculus GN=Aimp2 PE=1 SV=2 MPMYQVKPYHGGSAPLHVELPTCMYRLPNVHSKTTSPATDAGHVQETSEPSLQALESRQDDILKRLYELKAAVDGLSKMIHTPDADLDVTNILQADEPTTLATNTLDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCERYRVLSTVHTHSSVKNVPENLVKCFGEQARKQSRHEYQLGFTLIWKNVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKHNAVTLTLIDSWVDIAMFQLREGSSKEKAAVFRSMNSALGRSPWLVGNELTVADVVLWSVLQQTGGSSGAAPTNVQRWLKSCENLAPFSTALQLLK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionscaffold protein in the multisynthase complex forms a multi-protein complex with glutamyl-, prolyl-, isoelucyl-, leucyl-, methionyl-, glutaminyl-, lysyl-, arginyl-, and aspartyl-tRNA synthetases, AIMP1/p24, and AIMP3/p18
References for functionKim, Jin Young, et al. "p38 is essential for the assembly and stability of macromolecular tRNA synthetase complex: implications for its physiological significance." Proceedings of the National Academy of Sciences 99.12 (2002): 7912-7916.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionbinds to FUSE-binding protein (FBP), a transcriptional activator of c-myc the protein-protein interaction causes an increase in the ubiquitination and degradation of FBP, which results in downregulation of c-myc differentiation of lung cells
References for functionKim MJ, Park BJ, Kang YS, Kim HJ, Park JH, Kang JW, Lee SW, Han JM, Lee HW, Kim S. Downregulation of FUSE-binding protein and c-myc by tRNA synthetase cofactor p38 is required for lung cell differentiation. Nat Genet. 2003 Jul. PMID: 12819782
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments