Protein Information

General Information
MoonProt ID243
First appeared in release1.0
Name(s)Multisynthase complex auxiliary component p18 Aminoacyl tRNA synthase complex-interacting multifunctional protein 3 Gene Name: Aimp3
UniProt IDQ9D1M4
GO termsGO:0005515 protein binding GO:0006281 DNA repair
Organisms for which functions have been demonstratedMus musculus
Sequence length174 aa
FASTA sequence>sp|Q9D1M4|MCA3_MOUSE Eukaryotic translation elongation factor 1 epsilon-1 OS=Mus musculus GN=Eef1e1 PE=1 SV=1 MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHLLGSTAEEKAMVQQWLEFRVTRVDGHSSKEDTQTLLKDLNSYLEDKVYLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPDIRQHLSSIVFIKNRLYANSH
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionscaffold protein in the multisynthase complex forms a multi-protein complex with glutamyl-, prolyl-, isoelucyl-, leucyl-, methionyl-, glutaminyl-, lysyl-, arginyl-, and aspartyl-tRNA synthetases, AIMP2/p38, and AIMP3/p24
References for functionPark, Bum-Joon, et al. "The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR." Cell 120.2 (2005): 209-221.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionprotein-protein interaction with ATM/ATR that results in p53 activation translocates to nucleus and plays a role in DNA repair
References for functionPark BJ, Kang JW, Lee SW, Choi SJ, Shin YK, Ahn YH, Choi YH, Choi D, Lee KS, Kim S. The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR. Cell. 2005 Jan 28. PMID: 15680327
E.C. numberN/A
Location of functional site(s)
Cellular location of functionnucleus
Comments