Protein Information

General Information
MoonProt ID246
First appeared in release1.0
Name(s)50S ribosomal protein L1 Gene Name: rplA
UniProt IDP0A7L0 (RL1_ECOLI), Reviewed
GO termsGO:0006412 translation GO:0006417 regulation of translation GO:0045947 negative regulation of translational initiation GO:0000049 tRNA binding GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0005515 protein binding GO:0019843 rRNA binding GO:0005840 ribosome GO:0015934 large ribosomal subunit GO:0022625 cytosolic large ribosomal subunit GO:0030529 ribonucleoprotein complex GO:0003723 RNA binding GO:0006412 translation GO:0003729 mRNA binding
Organisms for which functions have been demonstratedEscherichia coli
Sequence length234
FASTA sequence>sp|P0A7L0|RL1_ECOLI 50S ribosomal protein L1 OS=Escherichia coli (strain K12) GN=rplA PE=1 SV=2 MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
Structure Information
PDB ID3KCR, 2WWQ, 3IZT, 3IZU, 3J01, 3J0T, 3J0W, 3J0Y, 3J11, 3J12, 3J14, 3J37, 3J46, 3J4X, 3J50, 3J51, 3J52, 3J54, 3J56, 3J58, 3J5A, 3J5C, 3J5E, 3J5G, 3J5I, 3J5K, 3J5S, 3FIK, 3J5U, 3J5W, 2RDO, 2GYC, 2GYA
Quaternary structure
Function 1
Function descriptionribosomal protein, part of the 50S subunit
References for functionBrauer, Dieter, and Irene Öchsner. "The primary structure of protein L1 from the large ribosomal subunit of Escherichia coli." FEBS letters 96.2 (1978): 317-321.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranslational repressor binds to the mRNA of the L11 operon
References for functionYates JL, Arfsten AE, Nomura M. In vitro expression of Escherichia coli ribosomal protein genes: autogenous inhibition of translation. Proc Natl Acad Sci U S A. 1980 Apr. PMID: 6445562
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments