Protein Information

General Information
MoonProt ID248
First appeared in release1.0
Name(s)S8 ribosomal protein 30S ribosomal protein S8 Gene Name: rpsH
UniProt IDP0A7W7 (RS8_ECOLI), Reviewed
GO termsGO:0006412 translation GO:0006417 regulation of translation GO:0043488 regulation of mRNA stability GO:0006412 translation GO:0003723 RNA binding GO:0003735 structural constituent of ribosome GO:0019843 rRNA binding GO:0005840 ribosome GO:0022627 cytosolic small ribosomal subunit GO:0030529 ribonucleoprotein complex
Organisms for which functions have been demonstratedEscherichia coli
Sequence length130
FASTA sequence>sp|P0A7W7|RS8_ECOLI 30S ribosomal protein S8 OS=Escherichia coli (strain K12) GN=rpsH PE=1 SV=2 MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
Structure Information
PDB ID1VS5, 1VS7, 3E1A, 3E1C, 3I1M, 3I1O, 3I1Q, 3I1S, 3I1Z, 3I21, 3KC4, 3OR9, 3ORA, 3IZV, 3IZW, 3SFS, 3UOQ, 4GAQ, 4GAS, 4KIY, 4KJ0, 4KJ2, 4KJ4, 4KJ6, 4KJ8, 4KJA, 4KJC, 3J4V, 3J4W, 3J4Y, 3J4Z, 3J53, 1P87, 1S03, 2AVY, 2AW7, 2I2P, 2I2U, 2QOU, 2QOW, 2QOY, 2OP0, 2QA
Quaternary structure
Function 1
Function descriptionS8 ribosomal protein part of the 30S subunit binds to 16S rRNA
References for functionALLEN, Geoffrey, and Brigitte WITTMANN-LIEBOLD. "The amino acid sequence of the ribosomal protein S8 of Escherichia coli." Hoppe-Seyler´ s Zeitschrift für physiologische Chemie 359.2 (1978): 1509-1526.
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptiontranslational repressor inhibits expression of some proteins encoded by the spc operon
References for functionYates JL, Arfsten AE, Nomura M. In vitro expression of Escherichia coli ribosomal protein genes: autogenous inhibition of translation. Proc Natl Acad Sci U S A. 1980 Apr. PMID: 6445562
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments