Protein Information

General Information
MoonProt ID258
First appeared in release1.0
Name(s)Peptidyl-tRNA hydrolase 2, mitochondrial PTH 2 Bcl-2 inhibitor of transcription 1 Gene Name:PTRH2
UniProt IDQ9Y3E5 (PTH2_HUMAN), Reviewed
GO termsGO:0006915 apoptotic process GO:0008152 metabolic process GO:0010629 negative regulation of gene expression GO:2000210 positive regulation of anoikis GO:2000811 negative regulation of anoikis GO:0004045 aminoacyl-tRNA hydrolase activity GO:0005515 protein binding GO:0016787 hydrolase activity GO:0005739 mitochondrion GO:0005829 cytosol GO:0005515 protein binding GO:0006351 transcription, DNA-templated
Organisms for which functions have been demonstratedHomo sapiens
Sequence length179
FASTA sequence>sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens GN=PTRH2 PE=1 SV=1 MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Structure Information
PDB ID1Q7S
Quaternary structure
Function 1
Function descriptionPeptidyl-tRNA hydrolase, enzyme aminoacyl-tRNA + H2O => amino acid + tRNA releases tRNA from the premature translation termination product
References for functionDe Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5. PMID: 14660562
E.C. number3.1.1.29
Location of functional site(s)
Cellular location of functionmitochondrion
Comments
Function 2
Function descriptioninhibitor of transcription protein-protein interaction
References for functionDe Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5. PMID: 14660562
E.C. numberN/A
Location of functional site(s)
Cellular location of functionmitochondrion
Comments