Protein Information

General Information
MoonProt ID262
First appeared in release1.0
Name(s)Peroxiredoxin TSA1 Cytoplasmic thiol peroxidase 1 cTPx 1 PRP Thiol-specific antioxidant protein 1 Thioredoxin peroxidase Gene Name:TSA1
UniProt IDP34760 (TSA1_YEAST), Reviewed
GO termsGO:0000077 DNA damage checkpoint GO:0001302 replicative cell aging GO:0006457 protein folding GO:0033194 response to hydroperoxide GO:0034599 cellular response to oxidative stress GO:0042262 DNA protection GO:0045454 cell redox homeostasis GO:0055114 oxidation-reduction process GO:0061077 chaperone-mediated protein folding GO:0004601 peroxidase activity GO:0008379 thioredoxin peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0043022 ribosome binding GO:0051082 unfolded protein binding GO:0051920 peroxiredoxin activity GO:0005737 cytoplasm GO:0005829 cytosol GO:0005844 polysome GO:0061077 chaperone-mediated protein folding
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length196
FASTA sequence>sp|P34760|TSA1_YEAST Peroxiredoxin TSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA1 PE=1 SV=3 MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK
Structure Information
PDB ID3SBC
Quaternary structure
Function 1
Function descriptionperoxiredoxin peroxidase antioxidant 2 R'-SH + ROOH => R'-S-S-R' + H2O + ROH.
References for functionTrotter, Eleanor W., et al. "The yeast Tsa1 peroxiredoxin is a ribosome-associated antioxidant." Biochemical Journal 412.1 (2008): 73-80.
E.C. number1.11.1.15
Location of functional site(s)site: 45; active site: 48; binding site: 124
Cellular location of functioncytooplasm
Comments
Function 2
Function descriptionmolecular chaperones helps proteins fold
References for functionJang HH, Lee KO, Chi YH, Jung BG, Park SK, Park JH, Lee JR, Lee SS, Moon JC, Yun JW, Choi YO, Kim WY, Kang JS, Cheong GW, Yun DJ, Rhee SG, Cho MJ, Lee SY. Two enzymes in one; two yeast peroxiredoxins display oxidative stress-dependent switching from a peroxidase to a molecular chaperone function. Cell. 2004 May 28;117(5):625-35. PMID: 15163410
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments