Protein Information

General Information
MoonProt ID263
First appeared in release1.0
Name(s)Peroxiredoxin 2 TSA2 Cytoplasmic thiol peroxidase 2 cTPx 2 Thiol-specific antioxidant protein 2 Thioredoxin peroxidase 2 Gene Name:TSA2
UniProt IDQ04120 (TSA2_YEAST), Reviewed
GO termsGO:0034599 cellular response to oxidative stress GO:0045454 cell redox homeostasis GO:0055114 oxidation-reduction process GO:0004601 peroxidase activity GO:0008379 thioredoxin peroxidase activity GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0051920 peroxiredoxin activity GO:0005737 cytoplasm GO:0061077 chaperone-mediated protein folding
Organisms for which functions have been demonstratedSaccharomyces cerevisiae
Sequence length196
FASTA sequence>sp|Q04120|TSA2_YEAST Peroxiredoxin TSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA2 PE=1 SV=3 MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATIKPDVKDSKEYFKNANN
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionperoxiredoxin peroxidase antioxidant 2 R'-SH + ROOH => R'-S-S-R' + H2O + ROH
References for functionTanaka, Tomoaki, Shingo Izawa, and Yoshiharu Inoue. "GPX2, encoding a phospholipid hydroperoxide glutathione peroxidase homologue, codes for an atypical 2-Cys peroxiredoxin in Saccharomyces cerevisiae." Journal of Biological Chemistry280.51 (2005): 42078-42087.
E.C. number1.11.1.15
Location of functional site(s)active site: 48
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionmolecular chaperones helps proteins fold
References for functionJang HH, Lee KO, Chi YH, Jung BG, Park SK, Park JH, Lee JR, Lee SS, Moon JC, Yun JW, Choi YO, Kim WY, Kang JS, Cheong GW, Yun DJ, Rhee SG, Cho MJ, Lee SY. Two enzymes in one; two yeast peroxiredoxins display oxidative stress-dependent switching from a peroxidase to a molecular chaperone function. Cell. 2004 May 28;117(5):625-35. PMID: 15163410
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm
Comments